KEGG   Homo sapiens (human): 1823Help
Entry
1823              CDS       T01001                                 

Gene name
DSC1, CDHF1, DG2/DG3
Definition
(RefSeq) desmocollin 1
  KO
K07600  desmocollin 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:hsa04515]
    1823 (DSC1)
Cell adhesion molecules [BR:hsa04515]
 Cadherins
  Major cadherins
   1823 (DSC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cadherin Cadherin_pro Cadherin_2 Cadherin_C Cadherin_3 Smim3 UPF0114
Motif
Other DBs
NCBI-GeneID: 1823
NCBI-ProteinID: NP_077739
OMIM: 125643
HGNC: 3035
Ensembl: ENSG00000134765
Vega: OTTHUMG00000131982
Pharos: Q08554(Tbio)
UniProt: Q08554
Structure
PDB: 

Position
18q12.1
AA seq 894 aa AA seqDB search
MALASAAPGSIFCKQLLFSLLVLTLLCDACQKVYLRVPSHLQAETLVGKVNLEECLKSAS
LIRSSDPAFRILEDGSIYTTHDLILSSERKSFSIFLSDGQRREQQEIKVVLSARENKSPK
KRHTKDTALKRSKRRWAPIPASLMENSLGPFPQHVQQIQSDAAQNYTIFYSISGPGVDKE
PFNLFYIEKDTGDIFCTRSIDREKYEQFALYGYATTADGYAPEYPLPLIIKIEDDNDNAP
YFEHRVTIFTVPENCRSGTSVGKVTATDLDEPDTLHTRLKYKILQQIPDHPKHFSIHPDT
GVITTTTPFLDREKCDTYQLIMEVRDMGGQPFGLFNTGTITISLEDENDNPPSFTETSYV
TEVEENRIDVEILRMKVQDQDLPNTPHSKAVYKILQGNENGNFIISTDPNTNEGVLCVVK
PLNYEVNRQVILQVGVINEAQFSKAASSQTPTMCTTTVTVKIIDSDEGPECHPPVKVIQS
QDGFPAGQELLGYKALDPEISSGEGLRYQKLGDEDNWFEINQHTGDLRTLKVLDRESKFV
KNNQYNISVVAVDAVGRSCTGTLVVHLDDYNDHAPQIDKEVTICQNNEDFAVLKPVDPDG
PENGPPFQFFLDNSASKNWNIEEKDGKTAILRQRQNLDYNYYSVPIQIKDRHGLVATHML
TVRVCDCSTPSECRMKDKSTRDVRPNVILGRWAILAMVLGSVLLLCILFTCFCVTAKRTV
KKCFPEDIAQQNLIVSNTEGPGEEVTEANIRLPMQTSNICDTSMSVGTVGGQGIKTQQSF
EMVKGGYTLDSNKGGGHQTLESVKGVGQGDTGRYAYTDWQSFTQPRLGEKVYLCGQDEEH
KHCEDYVCSYNYEGKGSLAGSVGCCSDRQEEEGLEFLDHLEPKFRTLAKTCIKK
NT seq 2685 nt NT seq  +upstreamnt  +downstreamnt
atggctctggcctctgctgccccagggagcatcttctgtaagcagctccttttctctctc
ctggttttaacattactttgcgatgcttgtcagaaagtttatcttcgagttccttctcat
cttcaggctgaaacacttgtaggcaaagtgaatctggaggagtgtctcaagtcggccagc
ctaatccggtccagtgaccctgccttcagaattctagaagatggctcaatttacacaaca
catgacctcattttgtcttctgaaaggaaaagtttttccattttcctttcagatggtcag
agacgggaacaacaagagataaaagttgtactgtcagcaagagaaaacaagtctcctaag
aagagacataccaaagacacagccctcaagcgcagcaagagacgatgggctcctattcca
gcttcattgatggagaactcgttgggtccatttccacaacacgttcagcagatccaatct
gatgctgcacagaattacaccatcttttattccataagtgggccaggcgtggacaaagaa
cccttcaatttgttttacatagagaaagacactggggatatcttttgtacaaggagcatt
gaccgtgagaaatatgaacagtttgcgttatatggctatgcaacaactgcagatggctat
gcaccagaatatccactccctttgatcatcaaaattgaagatgataatgataacgcccca
tattttgaacacagagtgactatctttactgtgcctgaaaattgccgatccggaacttca
gtgggaaaagtgaccgccacagaccttgacgaacctgacactctccatactcgtctgaaa
tataaaatcttacaacaaatcccagatcatccaaagcatttctccatacacccagatacc
ggtgtcatcaccacaactacaccttttctggatagagaaaaatgtgatacttaccagtta
ataatggaagtgcgagacatgggtggtcagcctttcggtttatttaatacaggaacaatt
actatttcacttgaggatgaaaatgacaatccaccatctttcacagaaacttcttatgtt
acagaagtagaagaaaacagaattgacgtggagattttacgaatgaaggtacaggatcag
gatttgccaaacactcctcactcaaaggctgtatacaaaatcctacaaggaaatgaaaat
ggaaacttcataattagcacagatccaaatacaaatgaaggagtgctgtgtgttgtcaag
ccattgaactatgaagtcaatcgccaagttattttgcaagttggtgtcattaacgaggca
caattctctaaagcagcgagctcacaaactcctacaatgtgcactacaactgtcaccgtt
aaaattatagacagtgatgagggccctgaatgccaccctccagtgaaagttattcagagt
caagatggcttcccagctggccaagaactccttggatacaaagcactggacccggaaata
tccagtggtgaaggcttaaggtatcagaagttaggggatgaagataactggtttgaaatt
aatcaacacactggcgacttgagaactctaaaagtactagatagagaatccaaatttgta
aaaaacaaccaatacaatatttcagttgttgcagtggatgcagttggccgatcttgcact
ggaacattagtagttcatttggatgattacaacgatcacgcacctcaaattgacaaagaa
gtgaccatttgtcagaataatgaggattttgctgttctgaaacctgtagatccagatgga
cctgaaaatggaccaccttttcaattctttctggataattctgccagtaaaaactggaac
atagaagaaaaggatggtaaaactgccattcttcgtcaacggcaaaatcttgattataac
tattattctgtgcctattcaaataaaagacaggcatggtttagttgcaacacatatgtta
acagtgagagtatgtgactgttcaactccatctgagtgtagaatgaaggataaaagtaca
agagacgttagaccaaatgtaatacttggaagatgggctattcttgctatggtgttgggt
tctgtattgttattatgtattctgtttacatgtttctgtgtcactgctaagagaacagtc
aagaaatgttttccagaagacatagcccagcaaaatttaattgtatcaaatactgaagga
cctggagaagaagtaacggaagcaaatattagactccccatgcagacatccaacatttgt
gacacaagcatgtctgttggtactgttggtggccagggaatcaaaacacagcaaagtttt
gagatggtcaaaggaggctacactttggattccaacaaaggaggtggacatcagaccttg
gagtccgtcaagggagtggggcagggagatactggcagatatgcgtacacggactggcag
agtttcacccaacctcggcttggcgaaaaggtgtatttgtgtggacaagatgaggagcat
aaacattgtgaagactacgtttgttcgtataactatgaaggcaaaggttctctggccggc
tcagtaggttgctgcagcgatcggcaggaagaagagggactggagtttctagatcacctg
gaacccaaatttaggacattagcaaagacatgcatcaagaaataa

DBGET integrated database retrieval system