KEGG   Homo sapiens (human): 1824
Entry
1824              CDS       T01001                                 

Symbol
DSC2, ARVD11, CDHF2, DG2, DGII/III, DSC3
Name
(RefSeq) desmocollin 2
  KO
K07601  desmocollin 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa05412  Arrhythmogenic right ventricular cardiomyopathy
Disease
H00293  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    1824 (DSC2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    1824 (DSC2)
   04515 Cell adhesion molecules [BR:hsa04515]
    1824 (DSC2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   1824 (DSC2)
Cell adhesion molecules [BR:hsa04515]
 Cadherins
  Major cadherins
   1824 (DSC2)
SSDB
Motif
Pfam: Cadherin Cadherin_pro Cadherin_C RibLong Cadherin_3
Other DBs
NCBI-GeneID: 1824
NCBI-ProteinID: NP_077740
OMIM: 125645
HGNC: 3036
Ensembl: ENSG00000134755
Vega: OTTHUMG00000131981
Pharos: Q02487(Tbio)
UniProt: Q02487
Structure
PDB: 
5ERP

Position
18q12.1
AA seq 901 aa
MEAARPSGSWNGALCRLLLLTLAILIFASDACKNVTLHVPSKLDAEKLVGRVNLKECFTA
ANLIHSSDPDFQILEDGSVYTTNTILLSSEKRSFTILLSNTENQEKKKIFVFLEHQTKVL
KKRHTKEKVLRRAKRRWAPIPCSMLENSLGPFPLFLQQVQSDTAQNYTIYYSIRGPGVDQ
EPRNLFYVERDTGNLYCTRPVDREQYESFEIIAFATTPDGYTPELPLPLIIKIEDENDNY
PIFTEETYTFTIFENCRVGTTVGQVCATDKDEPDTMHTRLKYSIIGQVPPSPTLFSMHPT
TGVITTTSSQLDRELIDKYQLKIKVQDMDGQYFGLQTTSTCIINIDDVNDHLPTFTRTSY
VTSVEENTVDVEILRVTVEDKDLVNTANWRANYTILKGNENGNFKIVTDAKTNEGVLCVV
KPLNYEEKQQMILQIGVVNEAPFSREASPRSAMSTATVTVNVEDQDEGPECNPPIQTVRM
KENAEVGTTSNGYKAYDPETRSSSGIRYKKLTDPTGWVTIDENTGSIKVFRSLDREAETI
KNGIYNITVLASDQGGRTCTGTLGIILQDVNDNSPFIPKKTVIICKPTMSSAEIVAVDPD
EPIHGPPFDFSLESSTSEVQRMWRLKAINDTAARLSYQNDPPFGSYVVPITVRDRLGMSS
VTSLDVTLCDCITENDCTHRVDPRIGGGGVQLGKWAILAILLGIALLFCILFTLVCGASG
TSKQPKVIPDDLAQQNLIVSNTEAPGDDKVYSANGFTTQTVGASAQGVCGTVGSGIKNGG
QETIEMVKGGHQTSESCRGAGHHHTLDSCRGGHTEVDNCRYTYSEWHSFTQPRLGEKVYL
CNQDENHKHAQDYVLTYNYEGRGSVAGSVGCCSERQEEDGLEFLDNLEPKFRTLAEACMK
R
NT seq 2706 nt   +upstreamnt  +downstreamnt
atggaggcagcccgcccctccggctcctggaacggagccctctgccggctgctcctgctg
accctcgcgatcttaatatttgccagtgatgcctgcaaaaatgtgacattacatgttccc
tccaaactagatgccgagaaacttgttggtagagttaacctgaaagagtgctttacagct
gcaaatctaattcattcaagtgatcctgacttccaaattttggaggatggttcagtctat
acaacaaatactattctattgtcctcggagaagagaagttttaccatattactttccaac
actgagaaccaagaaaagaagaaaatatttgtctttttggagcatcaaacaaaggtccta
aagaaaagacatactaaagaaaaagttctaaggcgcgccaagagaagatgggctccaatt
ccttgttcgatgctagaaaactccttgggtccttttccacttttccttcaacaggttcaa
tctgacacggcccaaaactataccatatactattccataagaggtcctggagttgaccaa
gaacctcggaatttattttatgtggagagagacactggaaacttgtattgtactcgtcct
gtagatcgtgagcagtatgaatcttttgagataattgcctttgcaacaactccagatggg
tatactccagaacttccactgcccctaataatcaaaatagaggatgaaaatgataactac
ccaatttttacagaagaaacttatacttttacaatttttgaaaattgcagagtgggcact
actgtgggacaagtgtgtgctactgacaaagatgagcctgacacgatgcacacacgcctg
aagtactccatcattgggcaggtgccaccatcacccaccctattttctatgcatccaact
acaggcgtgatcaccacaacatcatctcagctagacagagagttaattgacaagtaccag
ttgaaaataaaagtacaagacatggatggtcagtattttggtctacagacaacttcaact
tgtatcattaacattgatgatgtaaatgaccacttgccaacatttactcgtacttcttat
gtgacatcagtggaagaaaatacagttgatgtggaaatcttacgagttactgttgaggat
aaggacttagtgaatactgctaactggagagctaattataccattttaaagggcaatgaa
aatggcaattttaaaattgtaacagatgccaaaaccaatgaaggagttctttgtgtagtt
aagcctttgaattatgaagaaaagcaacagatgatcttgcaaattggtgtagttaatgaa
gctccattttccagagaggctagtccaagatcagccatgagcacagcaacagttactgtt
aatgtagaagatcaggatgagggccctgagtgtaaccctccaatacagactgttcgcatg
aaagaaaatgcagaagtgggaacaacaagcaatggatataaagcatatgacccagaaaca
agaagtagcagtggcataaggtataagaaattaactgatccaacagggtgggtcaccatt
gatgaaaatacaggatcaatcaaagttttcagaagcctggatagagaggcagagaccatc
aaaaatggcatatataatattacagtccttgcatcagaccaaggagggagaacatgtacg
gggacactgggcattatacttcaagacgtgaatgataacagcccattcatacctaaaaag
acagtgatcatctgcaaacccaccatgtcatctgcggagattgttgcggttgatcctgat
gagcctatccatggcccaccctttgactttagtctggagagttctacttcagaagtacag
agaatgtggagactgaaagcaattaatgatacagcagcacgtctttcctatcagaatgat
cctccatttggctcatatgtagtacctataacagtgagagatagacttggcatgtctagt
gtcacttcattggatgttacactgtgtgactgcattaccgaaaatgactgcacacatcgt
gtagatccaaggattggcggtggaggagtacaacttggaaagtgggccatccttgcaata
ttgttgggcatagcattgctcttttgcatcctgtttacgctggtctgtggggcttctggg
acgtctaaacaaccaaaagtaattcctgatgatttagcccagcagaacctaattgtatca
aacacagaagctcctggagatgacaaagtgtattctgcgaatggcttcacaacccaaact
gtgggcgcttctgctcagggagtttgtggcaccgtgggatcaggaatcaaaaacggaggt
caggagaccatcgaaatggtgaaaggaggacaccagacctcggaatcctgccggggggct
ggccaccatcacaccctggactcctgcaggggaggacacacggaggtggacaactgcaga
tacacttactcggagtggcacagttttactcagccccgtcttggtgaaaaagtgtatctg
tgtaatcaagatgaaaatcacaagcatgcccaagactatgtcctgacatataactatgaa
ggaagaggatcggtggctgggtctgtaggttgttgcagtgaacgacaagaagaagatggg
cttgaatttttggataatttggagcccaaatttaggacactagcagaagcatgcatgaag
agatga

DBGET integrated database retrieval system