KEGG   Homo sapiens (human): 183
Entry
183               CDS       T01001                                 

Gene name
AGT, ANHU, SERPINA8, hFLT1
Definition
(RefSeq) angiotensinogen
  KO
K09821  angiotensinogen
Organism
hsa  Homo sapiens (human)
Pathway
hsa04072  Phospholipase D signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04270  Vascular smooth muscle contraction
hsa04614  Renin-angiotensin system
hsa04924  Renin secretion
hsa04925  Aldosterone synthesis and secretion
hsa04927  Cortisol synthesis and secretion
hsa04931  Insulin resistance
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa04934  Cushing syndrome
hsa05200  Pathways in cancer
hsa05410  Hypertrophic cardiomyopathy
hsa05414  Dilated cardiomyopathy
Disease
H00575  Renal tubular dysgenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    183 (AGT)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    183 (AGT)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    183 (AGT)
   04614 Renin-angiotensin system
    183 (AGT)
   04925 Aldosterone synthesis and secretion
    183 (AGT)
   04927 Cortisol synthesis and secretion
    183 (AGT)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    183 (AGT)
   04270 Vascular smooth muscle contraction
    183 (AGT)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    183 (AGT)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    183 (AGT)
   05414 Dilated cardiomyopathy
    183 (AGT)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    183 (AGT)
   04933 AGE-RAGE signaling pathway in diabetic complications
    183 (AGT)
   04934 Cushing syndrome
    183 (AGT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    183 (AGT)
Peptidases and inhibitors [BR:hsa01002]
 Peptidase inhibitors
  Family I4: serpin family
   183 (AGT)
SSDB
Motif
Pfam: Serpin
Other DBs
NCBI-GeneID: 183
NCBI-ProteinID: NP_001369746
OMIM: 106150
HGNC: 333
Ensembl: ENSG00000135744
Vega: OTTHUMG00000037757
Pharos: P01019(Tbio)
CPD: C02135 C15850 C15851 C15852 C00873 C15849 C15848 C20970 C20971 C20972 C20973
Structure
PDB: 

Position
1q42.2
AA seq 476 aa
MAPAGVSLRATILCLLAWAGLAAGDRVYIHPFHLVIHNESTCEQLAKANAGKPKDPTFIP
APIQAKTSPVDEKALQDQLVLVAAKLDTEDKLRAAMVGMLANFLGFRIYGMHSELWGVVH
GATVLSPTAVFGTLASLYLGALDHTADRLQAILGVPWKDKNCTSRLDAHKVLSALQAVQG
LLVAQGRADSQAQLLLSTVVGVFTAPGLHLKQPFVQGLALYTPVVLPRSLDFTELDVAAE
KIDRFMQAVTGWKTGCSLMGASVDSTLAFNTYVHFQGKMKGFSLLAEPQEFWVDNSTSVS
VPMLSGMGTFQHWSDIQDNFSVTQVPFTESACLLLIQPHYASDLDKVEGLTFQQNSLNWM
KKLSPRTIHLTMPQLVLQGSYDLQDLLAQAELPAILHTELNLQKLSNDRIRVGEVLNSIF
FELEADEREPTESTQQLNKPEVLEVTLNRPFLFAVYDQSATALHFLGRVANPLSTA
NT seq 1431 nt   +upstreamnt  +downstreamnt
atggctcctgccggtgtgagcctgagggccaccatcctctgcctcctggcctgggctggc
ctggctgcaggtgaccgggtgtacatacaccccttccacctcgtcatccacaatgagagt
acctgtgagcagctggcaaaggccaatgccgggaagcccaaagaccccaccttcatacct
gctccaattcaggccaagacatcccctgtggatgaaaaggccctacaggaccagctggtg
ctagtcgctgcaaaacttgacaccgaagacaagttgagggccgcaatggtcgggatgctg
gccaacttcttgggcttccgtatatatggcatgcacagtgagctatggggcgtggtccat
ggggccaccgtcctctccccaacggctgtctttggcaccctggcctctctctatctggga
gccttggaccacacagctgacaggctacaggcaatcctgggtgttccttggaaggacaag
aactgcacctcccggctggatgcgcacaaggtcctgtctgccctgcaggctgtacagggc
ctgctagtggcccagggcagggctgatagccaggcccagctgctgctgtccacggtggtg
ggcgtgttcacagccccaggcctgcacctgaagcagccgtttgtgcagggcctggctctc
tatacccctgtggtcctcccacgctctctggacttcacagaactggatgttgctgctgag
aagattgacaggttcatgcaggctgtgacaggatggaagactggctgctccctgatggga
gccagtgtggacagcaccctggctttcaacacctacgtccacttccaagggaagatgaag
ggcttctccctgctggccgagccccaggagttctgggtggacaacagcacctcagtgtct
gttcccatgctctctggcatgggcaccttccagcactggagtgacatccaggacaacttc
tcggtgactcaagtgcccttcactgagagcgcctgcctgctgctgatccagcctcactat
gcctctgacctggacaaggtggagggtctcactttccagcaaaactccctcaactggatg
aagaaactatctccccggaccatccacctgaccatgccccaactggtgctgcaaggatct
tatgacctgcaggacctgctcgcccaggctgagctgcccgccattctgcacaccgagctg
aacctgcaaaaattgagcaatgaccgcatcagggtgggggaggtgctgaacagcattttt
tttgagcttgaagcggatgagagagagcccacagagtctacccaacagcttaacaagcct
gaggtcttggaggtgaccctgaaccgcccattcctgtttgctgtgtatgatcaaagcgcc
actgccctgcacttcctgggccgcgtggccaacccgctgagcacagcatga

DBGET integrated database retrieval system