KEGG   Homo sapiens (human): 183Help
Entry
183               CDS       T01001                                 

Gene name
AGT, ANHU, SERPINA8, hFLT1
Definition
(RefSeq) angiotensinogen
  KO
K09821  angiotensinogen
Organism
hsa  Homo sapiens (human)
Pathway
hsa04614  Renin-angiotensin system
hsa04924  Renin secretion
Disease
H00575  Renal tubular dysgenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    183 (AGT)
   04614 Renin-angiotensin system
    183 (AGT)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    183 (AGT)
 09160 Human Diseases
  09166 Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    183 (AGT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Serpin
Motif
Other DBs
NCBI-GeneID: 183
NCBI-ProteinID: NP_000020
OMIM: 106150
HGNC: 333
Ensembl: ENSG00000135744
Vega: OTTHUMG00000037757
Pharos: P01019(Tbio)
CPD: C02135 C15850 C15851 C15852 C00873 C15849 C15848 C20970 C20971 C20972 C20973
UniProt: P01019 B0ZBE2 B2R5S1
Structure
PDB: 

Position
1q42.2
AA seq 485 aa AA seqDB search
MRKRAPQSEMAPAGVSLRATILCLLAWAGLAAGDRVYIHPFHLVIHNESTCEQLAKANAG
KPKDPTFIPAPIQAKTSPVDEKALQDQLVLVAAKLDTEDKLRAAMVGMLANFLGFRIYGM
HSELWGVVHGATVLSPTAVFGTLASLYLGALDHTADRLQAILGVPWKDKNCTSRLDAHKV
LSALQAVQGLLVAQGRADSQAQLLLSTVVGVFTAPGLHLKQPFVQGLALYTPVVLPRSLD
FTELDVAAEKIDRFMQAVTGWKTGCSLMGASVDSTLAFNTYVHFQGKMKGFSLLAEPQEF
WVDNSTSVSVPMLSGMGTFQHWSDIQDNFSVTQVPFTESACLLLIQPHYASDLDKVEGLT
FQQNSLNWMKKLSPRTIHLTMPQLVLQGSYDLQDLLAQAELPAILHTELNLQKLSNDRIR
VGEVLNSIFFELEADEREPTESTQQLNKPEVLEVTLNRPFLFAVYDQSATALHFLGRVAN
PLSTA
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgcggaagcgagcaccccagtctgagatggctcctgccggtgtgagcctgagggccacc
atcctctgcctcctggcctgggctggcctggctgcaggtgaccgggtgtacatacacccc
ttccacctcgtcatccacaatgagagtacctgtgagcagctggcaaaggccaatgccggg
aagcccaaagaccccaccttcatacctgctccaattcaggccaagacatcccctgtggat
gaaaaggccctacaggaccagctggtgctagtcgctgcaaaacttgacaccgaagacaag
ttgagggccgcaatggtcgggatgctggccaacttcttgggcttccgtatatatggcatg
cacagtgagctatggggcgtggtccatggggccaccgtcctctccccaacggctgtcttt
ggcaccctggcctctctctatctgggagccttggaccacacagctgacaggctacaggca
atcctgggtgttccttggaaggacaagaactgcacctcccggctggatgcgcacaaggtc
ctgtctgccctgcaggctgtacagggcctgctagtggcccagggcagggctgatagccag
gcccagctgctgctgtccacggtggtgggcgtgttcacagccccaggcctgcacctgaag
cagccgtttgtgcagggcctggctctctatacccctgtggtcctcccacgctctctggac
ttcacagaactggatgttgctgctgagaagattgacaggttcatgcaggctgtgacagga
tggaagactggctgctccctgatgggagccagtgtggacagcaccctggctttcaacacc
tacgtccacttccaagggaagatgaagggcttctccctgctggccgagccccaggagttc
tgggtggacaacagcacctcagtgtctgttcccatgctctctggcatgggcaccttccag
cactggagtgacatccaggacaacttctcggtgactcaagtgcccttcactgagagcgcc
tgcctgctgctgatccagcctcactatgcctctgacctggacaaggtggagggtctcact
ttccagcaaaactccctcaactggatgaagaaactatctccccggaccatccacctgacc
atgccccaactggtgctgcaaggatcttatgacctgcaggacctgctcgcccaggctgag
ctgcccgccattctgcacaccgagctgaacctgcaaaaattgagcaatgaccgcatcagg
gtgggggaggtgctgaacagcattttttttgagcttgaagcggatgagagagagcccaca
gagtctacccaacagcttaacaagcctgaggtcttggaggtgaccctgaaccgcccattc
ctgtttgctgtgtatgatcaaagcgccactgccctgcacttcctgggccgcgtggccaac
ccgctgagcacagcatga

DBGET integrated database retrieval system