KEGG   Homo sapiens (human): 1830Help
Entry
1830              CDS       T01001                                 

Gene name
DSG3, CDHF6, PVA
Definition
(RefSeq) desmoglein 3
  KO
K07598  desmoglein 3
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:hsa04515]
    1830 (DSG3)
Cell adhesion molecules [BR:hsa04515]
 Cadherins
  Major cadherins
   1830 (DSG3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cadherin Cadherin_C Cadherin_3
Motif
Other DBs
NCBI-GeneID: 1830
NCBI-ProteinID: NP_001935
OMIM: 169615
HGNC: 3050
Ensembl: ENSG00000134757
Vega: OTTHUMG00000131985
Pharos: P32926(Tbio)
UniProt: P32926
Structure
PDB: 

Position
18q12.1
AA seq 999 aa AA seqDB search
MMGLFPRTTGALAIFVVVILVHGELRIETKGQYDEEEMTMQQAKRRQKREWVKFAKPCRE
GEDNSKRNPIAKITSDYQATQKITYRISGVGIDQPPFGIFVVDKNTGDINITAIVDREET
PSFLITCRALNAQGLDVEKPLILTVKILDINDNPPVFSQQIFMGEIEENSASNSLVMILN
ATDADEPNHLNSKIAFKIVSQEPAGTPMFLLSRNTGEVRTLTNSLDREQASSYRLVVSGA
DKDGEGLSTQCECNIKVKDVNDNFPMFRDSQYSARIEENILSSELLRFQVTDLDEEYTDN
WLAVYFFTSGNEGNWFEIQTDPRTNEGILKVVKALDYEQLQSVKLSIAVKNKAEFHQSVI
SRYRVQSTPVTIQVINVREGIAFRPASKTFTVQKGISSKKLVDYILGTYQAIDEDTNKAA
SNVKYVMGRNDGGYLMIDSKTAEIKFVKNMNRDSTFIVNKTITAEVLAIDEYTGKTSTGT
VYVRVPDFNDNCPTAVLEKDAVCSSSPSVVVSARTLNNRYTGPYTFALEDQPVKLPAVWS
ITTLNATSALLRAQEQIPPGVYHISLVLTDSQNNRCEMPRSLTLEVCQCDNRGICGTSYP
TTSPGTRYGRPHSGRLGPAAIGLLLLGLLLLLLAPLLLLTCDCGAGSTGGVTGGFIPVPD
GSEGTIHQWGIEGAHPEDKEITNICVPPVTANGADFMESSEVCTNTYARGTAVEGTSGME
MTTKLGAATESGGAAGFATGTVSGAASGFGAATGVGICSSGQSGTMRTRHSTGGTNKDYA
DGAISMNFLDSYFSQKAFACAEEDDGQEANDCLLIYDNEGADATGSPVGSVGCCSFIADD
LDDSFLDSLGPKFKKLAEISLGVDGEGKEVQPPSKDSGYGIESCGHPIEVQQTGFVKCQT
LSGSQGASALSTSGSVQPAVSIPDPLQHGNYLVTETYSASGSLVQPSTAGFDPLLTQNVI
VTERVICPISSVPGNLAGPTQLRGSHTMLCTEDPCSRLI
NT seq 3000 nt NT seq  +upstreamnt  +downstreamnt
atgatggggctcttccccagaactacaggggctctggccatcttcgtggtggtcatattg
gttcatggagaattgcgaatagagactaaaggtcaatatgatgaagaagagatgactatg
caacaagctaaaagaaggcaaaaacgtgaatgggtgaaatttgccaaaccctgcagagaa
ggagaagataactcaaaaagaaacccaattgccaagattacttcagattaccaagcaacc
cagaaaatcacctaccgaatctctggagtgggaatcgatcagccgccttttggaatcttt
gttgttgacaaaaacactggagatattaacataacagctatagtcgaccgggaggaaact
ccaagcttcctgatcacatgtcgggctctaaatgcccaaggactagatgtagagaaacca
cttatactaacggttaaaattttggatattaatgataatcctccagtattttcacaacaa
attttcatgggtgaaattgaagaaaatagtgcctcaaactcactggtgatgatactaaat
gccacagatgcagatgaaccaaaccacttgaattctaaaattgccttcaaaattgtctct
caggaaccagcaggcacacccatgttcctcctaagcagaaacactggggaagtccgtact
ttgaccaattctcttgaccgagagcaagctagcagctatcgtctggttgtgagtggtgca
gacaaagatggagaaggactatcaactcaatgtgaatgtaatattaaagtgaaagatgtc
aacgataacttcccaatgtttagagactctcagtattcagcacgtattgaagaaaatatt
ttaagttctgaattacttcgatttcaagtaacagatttggatgaagagtacacagataat
tggcttgcagtatatttctttacctctgggaatgaaggaaattggtttgaaatacaaact
gatcctagaactaatgaaggcatcctgaaagtggtgaaggctctagattatgaacaacta
caaagcgtgaaacttagtattgctgtcaaaaacaaagctgaatttcaccaatcagttatc
tctcgataccgagttcagtcaaccccagtcacaattcaggtaataaatgtaagagaagga
attgcattccgtcctgcttccaagacatttactgtgcaaaaaggcataagtagcaaaaaa
ttggtggattatatcctgggaacatatcaagccatcgatgaggacactaacaaagctgcc
tcaaatgtcaaatatgtcatgggacgtaacgatggtggatacctaatgattgattcaaaa
actgctgaaatcaaatttgtcaaaaatatgaaccgagattctactttcatagttaacaaa
acaatcacagctgaggttctggccatagatgaatacacgggtaaaacttctacaggcacg
gtatatgttagagtacccgatttcaatgacaattgtccaacagctgtcctcgaaaaagat
gcagtttgcagttcttcaccttccgtggttgtctccgctagaacactgaataatagatac
actggcccctatacatttgcactggaagatcaacctgtaaagttgcctgccgtatggagt
atcacaaccctcaatgctacctcggccctcctcagagcccaggaacagatacctcctgga
gtataccacatctccctggtacttacagacagtcagaacaatcggtgtgagatgccacgc
agcttgacactggaagtctgtcagtgtgacaacaggggcatctgtggaacttcttaccca
accacaagccctgggaccaggtatggcaggccgcactcagggaggctggggcctgccgcc
atcggcctgctgctccttggtctcctgctgctgctgttggccccccttctgctgttgacc
tgtgactgtggggcaggttctactgggggagtgacaggtggttttatcccagttcctgat
ggctcagaaggaacaattcatcagtggggaattgaaggagcccatcctgaagacaaggaa
atcacaaatatttgtgtgcctcctgtaacagccaatggagccgatttcatggaaagttct
gaagtttgtacaaatacgtatgccagaggcacagcggtggaaggcacttcaggaatggaa
atgaccactaagcttggagcagccactgaatctggaggtgctgcaggctttgcaacaggg
acagtgtcaggagctgcttcaggattcggagcagccactggagttggcatctgttcctca
gggcagtctggaaccatgagaacaaggcattccactggaggaaccaataaggactacgct
gatggggcgataagcatgaattttctggactcctacttttctcagaaagcatttgcctgt
gcggaggaagacgatggccaggaagcaaatgactgcttgttgatctatgataatgaaggc
gcagatgccactggttctcctgtgggctccgtgggttgttgcagttttattgctgatgac
ctggatgacagcttcttggactcacttggacccaaatttaaaaaacttgcagagataagc
cttggtgttgatggtgaaggcaaagaagttcagccaccctctaaagacagcggttatggg
attgaatcctgtggccatcccatagaagtccagcagacaggatttgttaagtgccagact
ttgtcaggaagtcaaggagcttctgctttgtccacctctgggtctgtccagccagctgtt
tccatccctgaccctctgcagcatggtaactatttagtaacggagacttactcggcttct
ggttccctcgtgcaaccttccactgcaggctttgatccacttctcacacaaaatgtgata
gtgacagaaagggtgatctgtcccatttccagtgttcctggcaacctagctggcccaacg
cagctacgagggtcacatactatgctctgtacagaggatccttgctcccgtctaatatga

DBGET integrated database retrieval system