KEGG   Homo sapiens (human): 1836
Entry
1836              CDS       T01001                                 

Gene name
SLC26A2, D5S1708, DTD, DTDST, EDM4, MST153, MSTP157
Definition
(RefSeq) solute carrier family 26 member 2
  KO
K14701  solute carrier family 26 (sulfate anion transporter), member 2
Organism
hsa  Homo sapiens (human)
Disease
H00476  Multiple epiphyseal dysplasia
H00515  Atelosteogenesis type II
H02063  Diastrophic dysplasia
H02065  Achondrogenesis type IB
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    1836 (SLC26A2)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC26: Multifunctional anion exchanger
   1836 (SLC26A2)
SSDB
Motif
Pfam: Sulfate_transp STAS DUF364 STAS_2
Other DBs
NCBI-GeneID: 1836
NCBI-ProteinID: NP_000103
OMIM: 606718
HGNC: 10994
Ensembl: ENSG00000155850
Vega: OTTHUMG00000130054
Pharos: P50443(Tbio)
UniProt: P50443
Position
5q32
AA seq 739 aa
MSSESKEQHNVSPRDSAEGNDSYPSGIHLELQRESSTDFKQFETNDQCRPYHRILIERQE
KSDTNFKEFVIKKLQKNCQCSPAKAKNMILGFLPVLQWLPKYDLKKNILGDVMSGLIVGI
LLVPQSIAYSLLAGQEPVYGLYTSFFASIIYFLLGTSRHISVGIFGVLCLMIGETVDREL
QKAGYDNAHSAPSLGMVSNGSTLLNHTSDRICDKSCYAIMVGSTVTFIAGVYQVAMGFFQ
VGFVSVYLSDALLSGFVTGASFTILTSQAKYLLGLNLPRTNGVGSLITTWIHVFRNIHKT
NLCDLITSLLCLLVLLPTKELNEHFKSKLKAPIPIELVVVVAATLASHFGKLHENYNSSI
AGHIPTGFMPPKVPEWNLIPSVAVDAIAISIIGFAITVSLSEMFAKKHGYTVKANQEMYA
IGFCNIIPSFFHCFTTSAALAKTLVKESTGCHTQLSGVVTALVLLLVLLVIAPLFYSLQK
SVLGVITIVNLRGALRKFRDLPKMWSISRMDTVIWFVTMLSSALLSTEIGLLVGVCFSIF
CVILRTQKPKSSLLGLVEESEVFESVSAYKNLQIKPGIKIFRFVAPLYYINKECFKSALY
KQTVNPILIKVAWKKAAKRKIKEKVVTLGGIQDEMSVQLSHDPLELHTIVIDCSAIQFLD
TAGIHTLKEVRRDYEAIGIQVLLAQCNPTVRDSLTNGEYCKKEEENLLFYSVYEAMAFAE
VSKNQKGVCVPNGLSLSSD
NT seq 2220 nt   +upstreamnt  +downstreamnt
atgtcttcagaaagtaaagagcaacataacgtttcacccagagactcagctgaaggaaat
gacagttatccatctgggatccatctggaacttcaaagggaatcaagtactgacttcaag
caatttgagaccaatgatcaatgcagaccttatcataggatccttattgagcgtcaagag
aaatcagatacaaacttcaaggagtttgttattaaaaagctgcagaagaattgccagtgc
agtccagccaaagccaaaaatatgattttaggtttccttcctgttttgcagtggctccca
aaatacgacctaaagaaaaacattttaggggatgtgatgtcaggcttgattgtgggcata
ttattggtgccccagtccattgcttattccctgctggctggccaagaacctgtctatggt
ctgtacacatctttttttgccagcatcatttattttctcttgggtacctcccgtcacatc
tctgtgggcatttttggagtactgtgccttatgattggtgagacagttgaccgagaacta
cagaaagctggctatgacaatgcccatagtgctccttccttaggaatggtttcaaatggg
agcacattattaaatcatacatcagacaggatatgtgacaaaagttgctatgcaattatg
gttggcagcactgtaacctttatagctggagtttatcaggtagcgatgggcttctttcaa
gtgggttttgtttctgtctacctctcagatgccttgctgagtggatttgtcactggtgcc
tccttcactattcttacatctcaggccaagtatcttcttgggctcaaccttcctcggact
aatggtgtgggctcactcatcactacctggatacatgtcttcagaaacatccataagacc
aatctctgtgatcttatcaccagccttttgtgccttttggttcttttgccaaccaaagaa
ctcaatgaacacttcaaatccaagcttaaggcaccgattcctattgaacttgttgttgtt
gtagcagccacattagcctctcattttggaaaactacatgaaaattataattctagtatt
gctggacatattcccactgggtttatgccacccaaagtaccagaatggaacctaattcct
agtgtggctgtagatgcaatagctatttccatcattggttttgctatcactgtatcactt
tctgagatgtttgccaagaaacatggttacacagtcaaagcaaaccaggaaatgtatgcc
attggcttttgtaatatcatcccttccttcttccactgttttactactagtgcagctctt
gcaaagacattggttaaagaatcaacaggctgccatactcagctttctggtgtggtaaca
gccctggttcttttgttggtcctcctagtaatagctcctttgttctattcccttcaaaaa
agtgtccttggtgtgatcacaattgtaaatctacggggagcccttcgtaaatttagggat
cttcccaaaatgtggagtattagtagaatggatacagttatctggtttgttactatgctg
tcctctgcactgctaagtactgaaataggcctacttgttggggtttgtttttctatattt
tgtgtcatcctccgcactcagaagccaaagagttcactgcttggcttggtggaagagtct
gaggtctttgaatctgtgtctgcttacaagaaccttcagattaagccaggcatcaagatt
ttccgctttgtagcccctctctactacataaacaaagaatgctttaaatctgctttatac
aaacaaactgtcaacccaatcttaataaaggtggcttggaagaaggcagcaaagagaaag
atcaaagaaaaagtagtgactcttggtggaatccaggatgaaatgtcagtgcaactttcc
catgatcccttggagctgcatactatagtgattgactgcagtgcaattcaatttttagat
acagcagggatccacacactgaaagaagttcgcagagattatgaagccattggaatccag
gttctgctggctcagtgcaatcccactgtgagggattccctaaccaacggagaatattgc
aaaaaggaagaagaaaaccttctcttctatagtgtgtatgaagcgatggcttttgcagaa
gtatctaaaaatcagaaaggagtatgtgttcccaatggtctgagtcttagtagtgattaa

DBGET integrated database retrieval system