KEGG   Homo sapiens (human): 1837Help
Entry
1837              CDS       T01001                                 

Gene name
DTNA, D18S892E, DRP3, DTN, DTN-A, LVNC1
Definition
(RefSeq) dystrobrevin alpha
Organism
hsa  Homo sapiens (human)
Disease
H01216  Left ventricular noncompaction (LVNC)
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_2 EF-hand_3 ZZ C1_2 CRISPR_Cse2 Seryl_tRNA_N SOGA FapA
Motif
Other DBs
NCBI-GeneID: 1837
NCBI-ProteinID: NP_001381
OMIM: 601239
HGNC: 3057
Ensembl: ENSG00000134769
Vega: OTTHUMG00000132309
Pharos: Q9Y4J8(Tbio)
UniProt: Q9Y4J8
Structure
PDB: 

Position
18q12.1
AA seq 743 aa AA seqDB search
MIEDSGKRGNTMAERRQLFAEMRAQDLDRIRLSTYRTACKLRFVQKKCNLHLVDIWNVIE
ALRENALNNLDPNTELNVSRLEAVLSTIFYQLNKRMPTTHQIHVEQSISLLLNFLLAAFD
PEGHGKISVFAVKMALATLCGGKIMDKLRYIFSMISDSSGVMVYGRYDQFLREVLKLPTA
VFEGPSFGYTEQSARSCFSQQKKVTLNGFLDTLMSDPPPQCLVWLPLLHRLANVENVFHP
VECSYCHSESMMGFRYRCQQCHNYQLCQDCFWRGHAGGSHSNQHQMKEYTSWKSPAKKLT
NALSKSLSCASSREPLHPMFPDQPEKPLNLAHIVDTWPPRPVTSMNDTLFSHSVPSSGSP
FITRSSPPKDSEVEQNKLLARAAPAFLKGKGIQYSLNVADRLADEHVLIGLYVNMLRNNP
SCMLESSNRLDEEHRLIARYAARLAAESSSSQPPQQRSAPDISFTIDANKQQRQLIAELE
NKNREILQEIQRLRLEHEQASQPTPEKAQQNPTLLAELRLLRQRKDELEQRMSALQESRR
ELMVQLEGLMKLLKTQGAGSPRSSPSHTISRPIPMPIRSASACSTPTHTPQDSLTGVGGD
VQEAFAQSSRRNLRNDLLVAADSITNTMSSLVKELNSEVGSETESNVDSEFARTQFEDLV
PSPTSEKAFLAQIHARKPGYIHSGATTSTMRGDMVTEDADPYVQPEDENYENDSVRQLEN
ELQMEEYLKQKLQDEAYQVSLQG
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
atgattgaagatagtgggaaaagaggaaataccatggcagaaagaagacagctgtttgca
gagatgagggctcaagatctggatcgcatccgactctccacctacagaacagcatgcaag
cttaggtttgttcagaagaaatgcaatttgcacctggtggacatatggaatgtcatagaa
gcattgcgggaaaatgctctgaacaacctggacccaaacactgaactcaacgtgtcccgc
ttagaggctgtgctctccactattttttaccagctcaacaaacggatgccaaccactcac
caaatccatgtggagcagtccatcagcctcctccttaacttcctgcttgcagcgtttgat
ccggaaggccatggtaaaatttcagtatttgctgtcaaaatggctttagccacattgtgt
ggagggaagatcatggacaaattaagatatattttctcaatgatttctgactccagtggg
gtgatggtttatggacgatatgaccaattccttcgggaagttctcaaactacccacggca
gtttttgaaggtccttcatttggttacacagaacagtcagccagatcctgtttctcccaa
cagaaaaaagtcacgttaaatggtttcttggacacgcttatgtcagatcctcccccgcag
tgtctggtctggttgcctcttctgcatcgactagcaaatgtggaaaatgtcttccatccg
gttgagtgttcctactgccacagtgagagtatgatgggatttcgctaccgatgccaacag
tgtcacaattaccagctctgtcaggactgcttctggaggggacatgccggtggttctcat
agcaaccagcaccaaatgaaagagtacacgtcatggaaatcacctgctaagaagctgact
aatgcattaagcaagtccctgagctgtgcttccagccgtgaacctttgcaccccatgttc
ccagatcagcctgagaagccactcaacttggctcacatcgttgatacttggcctcccaga
cctgtaaccagcatgaacgacaccctgttctcccactctgttccctcctcaggaagtcct
tttattaccaggagctctcctcccaaggacagtgaagtagagcagaacaaactgctggct
agggctgctccagcttttctgaagggcaaagggatacagtacagcctgaatgtggcagac
aggctagctgatgaacatgttctcatcgggttgtatgtcaacatgctccggaacaacccc
tcatgcatgcttgagagttcaaaccggcttgatgaagaacacaggctaattgccaggtat
gcggcaaggctggcagcagagtcctcttcgtctcagccacctcagcagagaagtgctcct
gacatctctttcaccatcgatgcgaataagcagcaaaggcagctgattgctgagctagaa
aacaagaacagagaaatcttacaggagatccagagacttcggctagagcatgaacaagct
tctcagcccacgccagagaaggcacagcaaaaccccaccctgctggcagaactccggctc
ctcagacagcgcaaagatgagctggaacagagaatgtctgctctccaggagagccggaga
gagctaatggtccagttggagggtctcatgaagctactaaagactcagggggcaggctct
ccccgctcctcccccagccacaccatcagcaggccaattcccatgcccatccggtcagcg
tcagcctgctccaccccgacgcacacgccgcaggactccctcacaggagtagggggagat
gtacaagaggcatttgcacaaagttcaagaagaaacttaaggaatgacttgctagtggct
gcagattccatcactaacactatgtcctctcttgtgaaagagctgaattctgaggttggg
agtgaaacagagagtaatgtggattctgaatttgcacggactcagtttgaggatcttgtt
ccctcaccaacctctgaaaaggcttttctagcgcaaatccatgcccgaaaacctgggtac
attcacagtggagctaccacaagtaccatgcgtggcgacatggttacggaggatgcagat
ccctatgtgcagcctgaagatgaaaactatgaaaatgactctgtccggcagctggagaat
gagctccagatggaggaatacctgaaacagaagctgcaagatgaagcttatcaggtcagc
ttgcaaggttga

DBGET integrated database retrieval system