KEGG   Homo sapiens (human): 1841
Entry
1841              CDS       T01001                                 

Symbol
DTYMK, CDC8, PP3731, TMPK, TYMK
Name
(RefSeq) deoxythymidylate kinase
  KO
K00943  dTMP kinase [EC:2.7.4.9]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00240  Pyrimidine metabolism
hsa01100  Metabolic pathways
Module
hsa_M00938  Pyrimidine deoxyribonuleotide biosynthesis, UDP => dTTP
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    1841 (DTYMK)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.9  dTMP kinase
     1841 (DTYMK)
SSDB
Motif
Pfam: Thymidylate_kin AAA_33
Other DBs
NCBI-GeneID: 1841
NCBI-ProteinID: NP_036277
OMIM: 188345
HGNC: 3061
Ensembl: ENSG00000168393
Vega: OTTHUMG00000133409
Pharos: P23919(Tbio)
UniProt: P23919 Q6FGU2
Structure
PDB: 

Position
2q37.3
AA seq 212 aa
MAARRGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLLSSYLQKK
SDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCKQP
DVGLPKPDLVLFLQLQLADAAKRGAFGHERYENGAFQERALRCFHQLMKDTTLNWKMVDA
SKSIEAVHEDIRVLSEDAIRTATEKPLGELWK
NT seq 639 nt   +upstreamnt  +downstreamnt
atggcggcccggcgcggggctctcatagtgctggagggcgtggaccgcgccgggaagagc
acgcagagccgcaagctggtggaagcgctgtgcgccgcgggccaccgcgccgaactgctc
cggttcccggaaagatcaactgaaatcggcaaacttctgagttcctacttgcaaaagaaa
agtgacgtggaggatcactcggtgcacctgcttttttctgcaaatcgctgggaacaagtg
ccgttaattaaggaaaagttgagccagggcgtgaccctcgtcgtggacagatacgcattt
tctggtgtggccttcaccggtgccaaggagaatttttccctagattggtgtaaacagcca
gacgtgggccttcccaaacccgacctggtcctgttcctccagttacagctggcggatgct
gccaagcggggagcgtttggccatgagcgctatgagaacggggctttccaggagcgggcg
ctccggtgtttccaccagctcatgaaagacacgactttgaactggaagatggtggatgct
tccaaaagcatcgaagctgtccatgaggacatccgcgtgctctctgaggacgccatccgc
actgccacagagaagccgctgggggagctatggaagtga

DBGET integrated database retrieval system