KEGG   Homo sapiens (human): 1842Help
Entry
1842              CDS       T01001                                 

Gene name
ECM2
Definition
(RefSeq) extracellular matrix protein 2
  KO
K08119  extracellular matrix protein 2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:hsa00535]
    1842 (ECM2)
Proteoglycans [BR:hsa00535]
 Extracellular matrix (ECM) proteoglycans
  Small leucine-rich proteoglycan (SLRP) family
   class I
    1842 (ECM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_8 LRR_4 VWC LRR_5 Amnionless LRR_9 LRR_6 Spore_coat_CotO
Motif
Other DBs
NCBI-GeneID: 1842
NCBI-ProteinID: NP_001384
OMIM: 603479
HGNC: 3154
Ensembl: ENSG00000106823
Vega: OTTHUMG00000020226
Pharos: O94769(Tdark)
UniProt: O94769
Position
9q22.31
AA seq 699 aa AA seqDB search
MKIAVLFCFFLLIIFQTDFGKNEEIPRKQRRKIYHRRLRKSSTSHKHRSNRQLGIQQTTV
FTPVARLPIVNFDYSMEEKFESFSSFPGVESSYNVLPGKKGHCLVKGITMYNKAVWSPEP
CTTCLCSDGRVLCDETMCHPQRCPQTVIPEGECCPVCSATVSYSLLSGIALNDRNEFSGD
SSEQREPTNLLHKQLPPPQVGMDRIVRKEALQSEEDEEVKEEDTEQKRETPESRNQGQLY
SEGDSRGGDRKQRPGEERRLAHQQQRQGREEEEDEEEEGEEGEEDEEDEEDPVRGDMFRM
PSRSPLPAPPRGTLRLPSGCSLSYRTISCINAMLTQIPPLTAPQITSLELTGNSIASIPD
EAFNGLPNLERLDLSKNNITSSGIGPKAFKLLKKLMRLNMDGNNLIQIPSQLPSTLEELK
VNENNLQAIDEESLSDLNQLVTLELEGNNLSEANVNPLAFKPLKSLAYLRLGKNKFRIIP
QGLPGSIEELYLENNQIEEITEICFNHTRKINVIVLRYNKIEENRIAPLAWINQENLESI
DLSYNKLYHVPSYLPKSLLHLVLLGNQIERIPGYVFGHMEPGLEYLYLSFNKLADDGMDR
VSFYGAYHSLRELFLDHNDLKSIPPGIQEMKALHFLRLNNNKIRNILPEEICNAEEDDDS
NLEHLHLENNYIKIREIPSYTFSCIRSYSSIVLKPQNIK
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atgaagattgcagttttgttttgtttttttctgcttatcatttttcaaactgactttgga
aaaaatgaagaaattcctaggaagcaaaggaggaagatctaccacagaaggttgaggaaa
agttcaacctcacacaagcacagatcaaacagacagcttggaattcagcaaacaacagtt
tttacaccagtagcaagacttcctattgttaactttgattatagcatggaggaaaagttt
gaatccttttcaagttttcctggagtagaatcaagttataatgtgttaccaggaaagaag
ggacactgtttggtaaagggcataaccatgtacaacaaagctgtgtggtcgcctgagccc
tgcactacctgcctctgctcagatggaagagttctttgtgatgaaaccatgtgccatccc
cagaggtgcccccaaacagttatacctgaaggggaatgctgcccggtctgctccgctact
gtctcctattctctactcagtggtatagcattaaatgatagaaatgaattttctggtgat
tcttcagaacaaagagaacctaccaatttacttcataagcaactgccacctcctcaggtg
ggaatggaccgaatagtaagaaaagaagcacttcaatctgaggaggatgaagaagtgaaa
gaagaagatacagagcaaaagagagagacccctgaatctagaaatcaggggcaactttac
agtgagggggacagcagaggaggagacagaaagcagaggcctggagaggagaggaggctg
gcacaccagcaacaacgccaaggaagggaggaggaggaggatgaggaggaggagggtgag
gagggtgaggaggatgaggaggacgaggaggacccggtaagaggagatatgttccgaatg
ccctctcgatccccgcttcctgctcctcccagaggcacactgcgcctgccaagcgggtgc
tctctgtcctacaggaccatcagctgcatcaacgccatgcttacccagataccaccgctg
acagcaccacagataacaagtctggagctcactggcaattccatcgcctccatcccagat
gaagcatttaatggattaccaaatttggaaaggcttgatctgagtaaaaataatatcact
tcttcaggcataggtccaaaagcattcaagcttctgaagaagttaatgcgtttgaatatg
gatggaaataatttgatacagattccttcacaattgccatctacattagaagaacttaaa
gtcaatgagaacaatcttcaggctatcgatgaagaaagtttatcagacttaaatcagttg
gtcaccttagaattggaaggaaacaatctcagtgaagccaatgtcaatcctttagctttc
aaacctttgaagagcctagcctacttgcgtctgggaaaaaataaatttagaattataccg
cagggtcttcctggttctattgaggaattatacctagaaaataaccaaattgaagaaata
actgaaatttgtttcaatcataccagaaagatcaatgtcattgtactacgttataacaaa
attgaagaaaataggattgctcctttagcctggataaatcaagaaaatctagaatccatt
gatctctcctacaacaagctctatcacgtcccgtcctatctacccaagtccttgctgcac
ctagtactccttgggaaccagattgaacggatccctggctatgtgtttggccacatggaa
ccaggcctggaatacttgtacctgtcatttaacaaacttgctgatgatggcatggaccgt
gtctccttctatggggcatatcattctctgagagaattatttctggatcacaatgactta
aaatctataccacctgggatacaagaaatgaaagcactacattttctgaggctgaacaac
aacaagatacggaacattcttccagaagaaatttgcaatgctgaagaggatgatgactca
aatctggaacatcttcatcttgaaaacaattatattaaaattagagaaataccatcttac
acattttcatgcataagatcatactcaagtatcgttcttaaaccacaaaacatcaagtaa

DBGET integrated database retrieval system