KEGG   Homo sapiens (human): 1843Help
Entry
1843              CDS       T01001                                 

Gene name
DUSP1, CL100, HVH1, MKP-1, MKP1, PTPN10
Definition
(RefSeq) dual specificity phosphatase 1
  KO
K21278  dual specificity protein phosphatase 1 [EC:3.1.3.16 3.1.3.48]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04726  Serotonergic synapse
hsa05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    1843 (DUSP1)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    1843 (DUSP1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    1843 (DUSP1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    1843 (DUSP1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     1843 (DUSP1)
    3.1.3.48  protein-tyrosine-phosphatase
     1843 (DUSP1)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   MAPK phosphatases
    1843 (DUSP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSPc Rhodanese Y_phosphatase Init_tRNA_PT
Motif
Other DBs
NCBI-GeneID: 1843
NCBI-ProteinID: NP_004408
OMIM: 600714
HGNC: 3064
Ensembl: ENSG00000120129
Vega: OTTHUMG00000130523
Pharos: P28562(Tchem)
UniProt: P28562 B4DU40
Position
5q35.1
AA seq 367 aa AA seqDB search
MVMEVGTLDAGGLRALLGERAAQCLLLDCRSFFAFNAGHIAGSVNVRFSTIVRRRAKGAM
GLEHIVPNAELRGRLLAGAYHAVVLLDERSAALDGAKRDGTLALAAGALCREARAAQVFF
LKGGYEAFSASCPELCSKQSTPMGLSLPLSTSVPDSAESGCSSCSTPLYDQGGPVEILPF
LYLGSAYHASRKDMLDALGITALINVSANCPNHFEGHYQYKSIPVEDNHKADISSWFNEA
IDFIDSIKNAGGRVFVHCQAGISRSATICLAYLMRTNRVKLDEAFEFVKQRRSIISPNFS
FMGQLLQFESQVLAPHCSAEAGSPAMAVLDRGTSTTTVFNFPVSIPVHSTNSALSYLQSP
ITTSPSC
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggtcatggaagtgggcaccctggacgctggaggcctgcgggcgctgctgggggagcga
gcggcgcaatgcctgctgctggactgccgctccttcttcgctttcaacgccggccacatc
gccggctctgtcaacgtgcgcttcagcaccatcgtgcggcgccgggccaagggcgccatg
ggcctggagcacatcgtgcccaacgccgagctccgcggccgcctgctggccggcgcctac
cacgccgtggtgttgctggacgagcgcagcgccgccctggacggcgccaagcgcgacggc
accctggccctggcggccggcgcgctctgccgcgaggcgcgcgccgcgcaagtcttcttc
ctcaaaggaggatacgaagcgttttcggcttcctgcccggagctgtgcagcaaacagtcg
acccccatggggctcagccttcccctgagtactagcgtccctgacagcgcggaatctggg
tgcagttcctgcagtaccccactctacgatcagggtggcccggtggaaatcctgcccttt
ctgtacctgggcagtgcgtatcacgcttcccgcaaggacatgctggatgccttgggcatc
actgccttgatcaacgtctcagccaattgtcccaaccattttgagggtcactaccagtac
aagagcatccctgtggaggacaaccacaaggcagacatcagctcctggttcaacgaggcc
attgacttcatagactccatcaagaatgctggaggaagggtgtttgtccactgccaggca
ggcatttcccggtcagccaccatctgccttgcttaccttatgaggactaatcgagtcaag
ctggacgaggcctttgagtttgtgaagcagaggcgaagcatcatctctcccaacttcagc
ttcatgggccagctgctgcagtttgagtcccaggtgctggctccgcactgttcggcagag
gctgggagccccgccatggctgtgctcgaccgaggcacctccaccaccaccgtgttcaac
ttccccgtctccatccctgtccactccacgaacagtgcgctgagctaccttcagagcccc
attacgacctctcccagctgctga

DBGET integrated database retrieval system