KEGG   Homo sapiens (human): 1846Help
Entry
1846              CDS       T01001                                 

Gene name
DUSP4, HVH2, MKP-2, MKP2, TYP
Definition
(RefSeq) dual specificity phosphatase 4
  KO
K04459  dual specificity MAP kinase phosphatase [EC:3.1.3.16 3.1.3.48]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    1846 (DUSP4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    1846 (DUSP4)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     1846 (DUSP4)
    3.1.3.48  protein-tyrosine-phosphatase
     1846 (DUSP4)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   MAPK phosphatases
    1846 (DUSP4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSPc Rhodanese Y_phosphatase CDKN3 PTPlike_phytase Myotub-related
Motif
Other DBs
NCBI-GeneID: 1846
NCBI-ProteinID: NP_001385
OMIM: 602747
HGNC: 3070
Ensembl: ENSG00000120875
Vega: OTTHUMG00000133395
Pharos: Q13115(Tbio)
UniProt: Q13115
Structure
PDB: 

Position
8p12
AA seq 394 aa AA seqDB search
MVTMEELREMDCSVLKRLMNRDENGGGAGGSGSHGTLGLPSGGKCLLLDCRPFLAHSAGY
ILGSVNVRCNTIVRRRAKGSVSLEQILPAEEEVRARLRSGLYSAVIVYDERSPRAESLRE
DSTVSLVVQALRRNAERTDICLLKGGYERFSSEYPEFCSKTKALAAIPPPVPPSATEPLD
LGCSSCGTPLHDQGGPVEILPFLYLGSAYHAARRDMLDALGITALLNVSSDCPNHFEGHY
QYKCIPVEDNHKADISSWFMEAIEYIDAVKDCRGRVLVHCQAGISRSATICLAYLMMKKR
VRLEEAFEFVKQRRSIISPNFSFMGQLLQFESQVLATSCAAEAASPSGPLRERGKTPATP
TSQFVFSFPVSVGVHSAPSSLPYLHSPITTSPSC
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggtgacgatggaggagctgcgggagatggactgcagtgtgctcaaaaggctgatgaac
cgggacgagaatggcggcggcgcgggcggcagcggcagccacggcaccctggggctgccg
agcggcggcaagtgcctgctgctggactgcagaccgttcctggcgcacagcgcgggctac
atcctaggttcggtcaacgtgcgctgtaacaccatcgtgcggcggcgggctaagggctcc
gtgagcctggagcagatcctgcccgccgaggaggaggtacgcgcccgcttgcgctccggc
ctctactcggcggtcatcgtctacgacgagcgcagcccgcgcgccgagagcctccgcgag
gacagcaccgtgtcgctggtggtgcaggcgctgcgccgcaacgccgagcgcaccgacatc
tgcctgctcaaaggcggctatgagaggttttcctccgagtacccagaattctgttctaaa
accaaggccctggcagccatcccacccccggttccccccagtgccacagagcccttggac
ctgggctgcagctcctgtgggaccccactacacgaccaggggggtcctgtggagatcctt
cccttcctctacctcggcagtgcctaccatgctgcccggagagacatgctggacgccctg
ggcatcacggctctgttgaatgtctcctcggactgcccaaaccactttgaaggacactat
cagtacaagtgcatcccagtggaagataaccacaaggccgacatcagctcctggttcatg
gaagccatagagtacatcgatgccgtgaaggactgccgtgggcgcgtgctggtgcactgc
caggcgggcatctcgcggtcggccaccatctgcctggcctacctgatgatgaagaaacgg
gtgaggctggaggaggccttcgagttcgttaagcagcgccgcagcatcatctcgcccaac
ttcagcttcatggggcagctgctgcagttcgagtcccaggtgctggccacgtcctgtgct
gcggaggctgctagcccctcgggacccctgcgggagcggggcaagacccccgccaccccc
acctcgcagttcgtcttcagctttccggtctccgtgggcgtgcactcggcccccagcagc
ctgccctacctgcacagccccatcaccacctctcccagctgttag

DBGET integrated database retrieval system