KEGG   Homo sapiens (human): 1854Help
Entry
1854              CDS       T01001                                 

Gene name
DUT, dUTPase
Definition
(RefSeq) deoxyuridine triphosphatase
  KO
K01520  dUTP pyrophosphatase [EC:3.6.1.23]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00240  Pyrimidine metabolism
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    1854 (DUT)
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    1854 (DUT)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.23  dUTP diphosphatase
     1854 (DUT)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    1854 (DUT)
 Prokaryotic Type
    1854 (DUT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: dUTPase
Motif
Other DBs
NCBI-GeneID: 1854
NCBI-ProteinID: NP_001020419
OMIM: 601266
HGNC: 3078
Ensembl: ENSG00000128951
Vega: OTTHUMG00000172155
Pharos: P33316(Tchem)
UniProt: P33316
Structure
PDB: 

Position
15q21.1
AA seq 252 aa AA seqDB search
MTPLCPRPALCYHFLTSLLRSAMQNARGARQRAEAAVLSGPGPPLGRAAQHGIPRPLSSA
GRLSQGCRGASTVGAAGWKGELPKAGGSPAPGPETPAISPSKRARPAEVGGMQLRFARLS
EHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKH
FIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTE
RGSGGFGSTGKN
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgactcccctctgccctcgccccgcgctctgctaccatttccttacgtctctgcttcgc
tcagcgatgcaaaacgcgcgaggcgcacggcagagggccgaagccgcggtactctccggg
ccaggcccgcccctcggccgcgccgcgcagcacgggattccccggccgctgtccagcgct
ggccgcctgagccaaggctgccgcggagccagtacagtcggggccgctggctggaagggc
gagcttcctaaggcggggggaagcccggcgccggggccggagacacccgccatttcaccc
agtaagcgggcccggcctgcggaggtgggcggcatgcagctccgctttgcccggctctcc
gagcacgccacggcccccacccggggctccgcgcgcgccgcgggctacgacctgtacagt
gcctatgattacacaataccacctatggagaaagctgttgtgaaaacggacattcagata
gcgctcccttctgggtgttatggaagagtggctccacggtcaggcttggctgcaaaacac
tttattgatgtaggagctggtgtcatagatgaagattatagaggaaatgttggtgttgta
ctgtttaattttggcaaagaaaagtttgaagtcaaaaaaggtgatcgaattgcacagctc
atttgcgaacggattttttatccagaaatagaagaagttcaagccttggatgacaccgaa
aggggttcaggaggttttggttccactggaaagaattaa

DBGET integrated database retrieval system