KEGG   Homo sapiens (human): 1855Help
Entry
1855              CDS       T01001                                 

Gene name
DVL1, DRS2, DVL, DVL1L1, DVL1P1
Definition
(RefSeq) dishevelled segment polarity protein 1
  KO
K02353  segment polarity protein dishevelled
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
hsa04310  Wnt signaling pathway
hsa04330  Notch signaling pathway
hsa04390  Hippo signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04916  Melanogenesis
hsa04934  Cushing syndrome
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05217  Basal cell carcinoma
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Module
hsa_M00677  Wnt signaling
Network
N00056  Wnt signaling pathway
N00059  FZD7-overexpression to Wnt signaling pathway
N00060  LRP6-overexpression to Wnt signaling pathway
Disease
H00485  Robinow syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    1855 (DVL1)
   04330 Notch signaling pathway
    1855 (DVL1)
   04390 Hippo signaling pathway
    1855 (DVL1)
   04150 mTOR signaling pathway
    1855 (DVL1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    1855 (DVL1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    1855 (DVL1)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    1855 (DVL1)
  09162 Cancers: Specific types
   05225 Hepatocellular carcinoma
    1855 (DVL1)
   05226 Gastric cancer
    1855 (DVL1)
   05217 Basal cell carcinoma
    1855 (DVL1)
   05224 Breast cancer
    1855 (DVL1)
  09167 Endocrine and metabolic diseases
   04934 Cushing syndrome
    1855 (DVL1)
  09172 Infectious diseases: Viral
   05165 Human papillomavirus infection
    1855 (DVL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Dishevelled Dsh_C DIX PDZ DEP PDZ_6 PDZ_2 Shufflon_N CDC45
Motif
Other DBs
NCBI-GeneID: 1855
NCBI-ProteinID: NP_001317240
OMIM: 601365
HGNC: 3084
Ensembl: ENSG00000107404
Vega: OTTHUMG00000003069
Pharos: O14640(Tbio)
UniProt: O14640
Position
1p36.33
AA seq 695 aa AA seqDB search
MAETKIIYHMDEEETPYLVKLPVAPERVTLADFKNVLSNRPVHAYKFFFKSMDQDFGVVK
EEIFDDNAKLPCFNGRVVSWLVLAEGAHSDAGSQGTDSHTDLPPPLERTGGIGDSRPPSF
HPNVASSRDGMDNETGTESMVSHRRERARRRNREEAARTNGHPRGDRRRDVGLPPDSAST
ALSSELESSSFVDSDEDGSTSRLSSSTEQSTSSRLIRKHKRRRRKQRLRQADRASSFSSI
TDSTMSLNIVTVTLNMERHHFLGISIVGQSNDRGDGGIYIGSIMKGGAVAADGRIEPGDM
LLQVNDVNFENMSNDDAVRVLREIVSQTGPISLTVAKCWDPTPRSYFTVPRADPVRPIDP
AAWLSHTAALTGALPRYGTSPCSSAVTRTSSSSLTSSVPGAPQLEEAPLTVKSDMSAVVR
VMQLPDSGLEIRDRMWLKITIANAVIGADVVDWLYTHVEGFKERREARKYASSLLKHGFL
RHTVNKITFSEQCYYVFGDLCSNLATLNLNSGSSGTSDQDTLAPLPHPAAPWPLGQGYPY
QYPGPPPCFPPAYQDPGFSYGSGSTGSQQSEGSKSSGSTRSSRRAPGREKERRAAGAGGS
GSESDHTAPSGVGSSWRERPAGQLSRGSSPRSQASATAPGLPPPHPTTKAYTVVGGPPGG
PPVRELAAVPPELTGSRQSFQKAMGNPCEFFVDIM
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atggcggagaccaagattatctaccacatggacgaggaggagacgccgtacctggtcaag
ctgcccgtggcccccgagcgcgtcacgctggccgacttcaagaacgtgctcagcaaccgg
cccgtgcacgcctacaaattcttctttaagtccatggaccaggacttcggggtggtgaag
gaggagatctttgatgacaatgccaagcttccctgcttcaacggccgcgtggtctcctgg
ctggtcctggctgagggtgctcactcggatgcggggtcccagggcacggacagccacaca
gacctgcccccgcctcttgagcggacaggcggcatcggggactcccggcccccctccttc
cacccaaatgtggccagcagccgtgacgggatggacaacgagacaggcacggagtccatg
gtcagtcaccggcgggagcgtgcccgacgccggaaccgcgaggaggccgcccggaccaat
gggcacccaaggggagaccgacggcgggatgtggggctgcccccagacagcgcgtccacc
gccctcagcagcgagcttgagtccagcagctttgtggactcggacgaggatggcagcacg
agcaggctcagcagctccacggagcagagcacctcatccagactcatccggaagcacaaa
cgccggcggaggaagcagcgccttcggcaggcggaccgggcctcctccttcagcagcata
accgactccaccatgtccctcaacatcgtcactgtcacgctcaacatggaaagacatcac
tttctgggcatcagcatcgtggggcagagcaacgaccgtggagacggcggcatctacatt
ggctccatcatgaagggcggggctgtggccgctgacggccgcatcgagcccggcgacatg
ttgctgcaggtgaatgacgtgaactttgagaacatgagcaatgacgatgccgtgcgggtg
ctgcgggagatcgtttcccagacggggcccatcagcctcactgtggccaagtgctgggac
ccaacgccccgaagctacttcaccgtcccacgggctgacccggtgcggcccatcgacccc
gccgcctggctgtcccacacggcggcactgacaggagccctgccccgctacggtacgagt
ccctgctccagcgccgtcacgcgcaccagctcctcctcactaaccagctccgtgcctggt
gctccacagctggaagaggcgccgctgacggtgaagagtgacatgagcgccgtcgtccgg
gtcatgcagctgccagactcgggactggagatccgcgaccgcatgtggctcaagatcacc
atcgccaatgccgtcatcggggcggacgtggtggactggctgtacacacacgtggagggc
ttcaaggagcggcgggaggcccggaagtacgccagcagcttgctgaagcacggcttcctg
cggcacacggtcaacaagatcaccttctccgagcagtgctactacgtcttcggggatctc
tgcagcaatctcgccaccctgaacctcaacagtggctccagtgggacttcggatcaggac
acgctggccccgctgccccacccggctgccccctggcctctgggtcagggctacccctac
cagtacccgggacccccaccctgcttcccgcctgcctaccaggacccgggctttagctat
ggcagcggcagcaccgggagtcagcagagtgaagggagcaaaagcagtgggtccacccgg
agcagccgccgggccccgggccgtgagaaggagcgtcgggcggcgggagctgggggcagt
ggcagtgaatcggatcacacggcaccgagtggggtggggagcagctggcgagagcgtccg
gccggccagctcagccgtggcagcagcccacgcagtcaggcctcggctaccgccccgggg
ctccccccgccccaccccacgaccaaggcctatacagtggtgggggggccacccggggga
ccccctgtccgggagctggctgccgtccccccggaattgacaggcagccgccagtccttc
cagaaggctatggggaacccctgcgagttcttcgtggacatcatgtga

DBGET integrated database retrieval system