KEGG   Homo sapiens (human): 186Help
Entry
186               CDS       T01001                                 

Gene name
AGTR2, AT2, ATGR2, MRX88
Definition
(RefSeq) angiotensin II receptor type 2
  KO
K04167  angiotensin II receptor type 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04614  Renin-angiotensin system
Drug target
Angiotensin II: D00150 D02014
Angiotensin II acetate: D11142
Angiotensinamide: D02939
Saralasin acetate: D04126
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    186 (AGTR2)
 09150 Organismal Systems
  09152 Endocrine system
   04614 Renin-angiotensin system
    186 (AGTR2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    186 (AGTR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    186 (AGTR2)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Angiotensin
    186 (AGTR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 FA_desaturase
Motif
Other DBs
NCBI-GeneID: 186
NCBI-ProteinID: NP_000677
OMIM: 300034
HGNC: 338
Ensembl: ENSG00000180772
Vega: OTTHUMG00000022243
Pharos: P50052(Tchem)
UniProt: P50052
Position
Xq23
AA seq 363 aa AA seqDB search
MKGNSTLATTSKNITSGLHFGLVNISGNNESTLNCSQKPSDKHLDAIPILYYIIFVIGFL
VNIVVVTLFCCQKGPKKVSSIYIFNLAVADLLLLATLPLWATYYSYRYDWLFGPVMCKVF
GSFLTLNMFASIFFITCMSVDRYQSVIYPFLSQRRNPWQASYIVPLVWCMACLSSLPTFY
FRDVRTIEYLGVNACIMAFPPEKYAQWSAGIALMKNILGFIIPLIFIATCYFGIRKHLLK
TNSYGKNRITRDQVLKMAAAVVLAFIICWLPFHVLTFLDALAWMGVINSCEVIAVIDLAL
PFAILLGFTNSCVNPFLYCFVGNRFQQKLRSVFRVPITWLQGKRESMSCRKSSSLREMET
FVS
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgaagggcaactccacccttgccactactagcaaaaacattaccagcggtcttcacttc
gggcttgtgaacatctctggcaacaatgagtctaccttgaactgttcacagaaaccatca
gataagcatttagatgcaattcctattctttactacattatatttgtaattggatttctg
gtcaatattgtcgtggttacactgttttgttgtcaaaagggtcctaaaaaggtttctagc
atatacatcttcaacctcgctgtggctgatttactccttttggctactcttcctctatgg
gcaacctattattcttatagatatgactggctctttggacctgtgatgtgcaaagttttt
ggttcttttcttaccctgaacatgtttgcaagcattttttttatcacctgcatgagtgtt
gataggtaccaatctgtcatctacccctttctgtctcaaagaagaaatccctggcaagca
tcttatatagttccccttgtttggtgtatggcctgtttgtcctcattgccaacattttat
tttcgagacgtcagaaccattgaatacttaggagtgaatgcttgcattatggctttccca
cctgagaaatatgcccaatggtcagctgggattgccttaatgaaaaatatccttggtttt
attatccctttaatattcatagcaacatgctattttggaattagaaaacacttactgaag
acgaatagctatgggaagaacaggataacccgtgaccaagtcctgaagatggcagctgct
gttgttctggccttcatcatttgctggcttcccttccatgttctgaccttcctggatgct
ctggcctggatgggtgtcattaatagctgcgaagttatagcagtcattgacctggcactt
ccttttgccatcctcttgggattcaccaacagctgcgttaatccgtttctgtattgtttt
gttggaaaccggttccaacagaagctccgcagtgtgtttagggttccaattacttggctc
caagggaaaagagagagtatgtcttgccggaaaagcagttctcttagagaaatggagacc
tttgtgtcttaa

DBGET integrated database retrieval system