KEGG   Homo sapiens (human): 1876
Entry
1876              CDS       T01001                                 

Gene name
E2F6, E2F-6
Definition
(RefSeq) E2F transcription factor 6
  KO
K09390  transcription factor E2F6
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    1876 (E2F6)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    1876 (E2F6)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP BRCA-2_OB3 TrmB DUF5719
Other DBs
NCBI-GeneID: 1876
NCBI-ProteinID: NP_937987
OMIM: 602944
HGNC: 3120
Ensembl: ENSG00000169016
Vega: OTTHUMG00000090565
Pharos: O75461(Tbio)
UniProt: O75461 A0A0S2Z3K8
Position
2p25.1
AA seq 281 aa
MSQQRPARKLPSLLLDPTEETVRRRCRDPINVEGLLPSKIRINLEDNVQYVSMRKALKVK
RPRFDVSLVYLTRKFMDLVRSAPGGILDLNKVATKLGVRKRRVYDITNVLDGIDLVEKKS
KNHIRWIGSDLSNFGAVPQQKKLQEELSDLSAMEDALDELIKDCAQQLFELTDDKENERL
AYVTYQDIHSIQAFHEQIVIAVKAPAETRLDVPAPREDSITVHIRSTNGPIDVYLCEVEQ
GQTSNKRSEGVGTSSSESTHPEGPEEEENPQQSEELLEVSN
NT seq 846 nt   +upstreamnt  +downstreamnt
atgagtcagcagcggccggcgaggaagttacccagtctcctcctggacccgacggaggag
acggttcgccgtcggtgccgagaccccatcaacgtggagggcctgctgccatcaaaaata
aggattaatttagaagataatgtacaatatgtgtccatgagaaaagctctaaaagtgaag
agacctcgttttgatgtatcgctggtttatttaactcgaaaatttatggatcttgtcaga
tctgctcccgggggtattcttgacttaaacaaggttgcaacgaaactgggagtccgaaag
cggagagtgtatgacatcaccaatgtcttagatggaatcgacctcgttgaaaagaaatcc
aagaaccatattagatggataggatctgatcttagcaattttggagcagttccccaacaa
aagaagctacaggaggaactttctgacttatcagcaatggaagatgctttggatgagtta
attaaggattgtgctcagcagctgtttgagttaacagatgacaaagaaaatgaaagacta
gcatatgtgacctatcaagacattcatagcattcaggccttccatgaacagatcgtcatt
gcagttaaagctccagcagaaaccagattggatgttccagctcccagagaagactctatc
acagtgcacataaggagcaccaacggacctatcgatgtctatttgtgtgaagtggagcag
ggtcagaccagtaacaaaaggtctgaaggtgtcgggacctcttcatctgagagcactcat
ccagaaggccctgaggaagaagaaaatcctcagcaaagtgaagaattgcttgaagtaagc
aactga

DBGET integrated database retrieval system