KEGG   Homo sapiens (human): 1890Help
Entry
1890              CDS       T01001                                 

Gene name
TYMP, ECGF, ECGF1, MEDPS1, MNGIE, MTDPS1, PDECGF, TP, hPD-ECGF
Definition
(RefSeq) thymidine phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00240  Pyrimidine metabolism
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
hsa05219  Bladder cancer
Disease
H00469  Mitochondrial DNA depletion syndrome (MDS)
H01390  Mitochondrial neurogastrointestinal encephalomyopathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    1890 (TYMP)
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    1890 (TYMP)
 Human Diseases
  Cancers
   05219 Bladder cancer
    1890 (TYMP)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     1890 (TYMP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_3 Glycos_trans_3N PYNP_C
Motif
Other DBs
NCBI-GeneID: 1890
NCBI-ProteinID: NP_001107227
OMIM: 131222
HGNC: 3148
Ensembl: ENSG00000025708
Vega: OTTHUMG00000150249
Pharos: P19971(Tclin)
UniProt: P19971 E5KRG5 B2RBL3
Structure
PDB: 

Position
22q13.33
AA seq 482 aa AA seqDB search
MAALMTPGTGAPPAPGDFSGEGSQGLPDPSPEPKQLPELIRMKRDGGRLSEADIRGFVAA
VVNGSAQGAQIGAMLMAIRLRGMDLEETSVLTQALAQSGQQLEWPEAWRQQLVDKHSTGG
VGDKVSLVLAPALAACGCKVPMISGRGLGHTGGTLDKLESIPGFNVIQSPEQMQVLLDQA
GCCIVGQSEQLVPADGILYAARDVTATVDSLPLITASILSKKLVEGLSALVVDVKFGGAA
VFPNQEQARELAKTLVGVGASLGLRVAAALTAMDKPLGRCVGHALEVEEALLCMDGAGPP
DLRDLVTTLGGALLWLSGHAGTQAQGAARVAAALDDGSALGRFERMLAAQGVDPGLARAL
CSGSPAERRQLLPRAREQEELLAPADGTVELVRALPLALVLHELGAGRSRAGEPLRLGVG
AELLVDVGQRLRRGTPWLRVHRDGPALSGPQSRALQEALVLSDRAPFAAPSPFAELVLPP
QQ
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggcagccttgatgaccccgggaaccggggccccacccgcgcctggtgacttctccggg
gaagggagccagggacttcccgacccttcgccagagcccaagcagctcccggagctgatc
cgcatgaagcgagacggaggccgcctgagcgaagcggacatcaggggcttcgtggccgct
gtggtgaatgggagcgcgcagggcgcacagatcggggccatgctgatggccatccgactt
cggggcatggatctggaggagacctcggtgctgacccaggccctggctcagtcgggacag
cagctggagtggccagaggcctggcgccagcagcttgtggacaagcattccacagggggt
gtgggtgacaaggtcagcctggtcctcgcacctgccctggcggcatgtggctgcaaggtg
ccaatgatcagcggacgtggtctggggcacacaggaggcaccttggataagctggagtct
attcctggattcaatgtcatccagagcccagagcagatgcaagtgctgctggaccaggcg
ggctgctgtatcgtgggtcagagtgagcagctggttcctgcggacggaatcctatatgca
gccagagatgtgacagccaccgtggacagcctgccactcatcacagcctccattctcagt
aagaaactcgtggaggggctgtccgctctggtggtggacgttaagttcggaggggccgcc
gtcttccccaaccaggagcaggcccgggagctggcaaagacgctggttggcgtgggagcc
agcctagggcttcgggtcgcggcagcgctgaccgccatggacaagcccctgggtcgctgc
gtgggccacgccctggaggtggaggaggcgctgctctgcatggacggcgcaggcccgcca
gacttaagggacctggtcaccacgctcgggggcgccctgctctggctcagcggacacgcg
gggactcaggcccagggcgctgcccgggtggccgcggcgctggacgacggctcggccctt
ggccgcttcgagcggatgctggcggcgcagggcgtggatcccggtctggcccgagccctg
tgctcgggaagtcccgcagaacgccggcagctgctgcctcgcgcccgggagcaggaggag
ctgctggcgcccgcagatggcaccgtggagctggtccgggcgctgccgctggcgctggtg
ctgcacgagctcggggccgggcgcagccgcgctggggagccgctccgcctgggggtgggc
gcagagctgctggtcgacgtgggtcagaggctgcgccgtgggaccccctggctccgcgtg
caccgggacggccccgcgctcagcggcccgcagagccgcgccctgcaggaggcgctcgta
ctctccgaccgcgcgccattcgccgccccctcgcccttcgcagagctcgttctgccgccg
cagcaataa

DBGET integrated database retrieval system