KEGG   Homo sapiens (human): 1891Help
Entry
1891              CDS       T01001                                 

Gene name
ECH1, HPXEL
Definition
(RefSeq) enoyl-CoA hydratase 1
  KO
K12663  Delta3,5-Delta2,4-dienoyl-CoA isomerase [EC:5.3.3.21]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    1891 (ECH1)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.21  Delta3,5-Delta2,4-dienoyl-CoA isomerase
     1891 (ECH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-GeneID: 1891
NCBI-ProteinID: NP_001389
OMIM: 600696
HGNC: 3149
Ensembl: ENSG00000104823
Vega: OTTHUMG00000182609
Pharos: Q13011(Tbio)
UniProt: Q13011 A0A384MR44
Structure
PDB: 

Position
19q13.2
AA seq 328 aa AA seqDB search
MAAGIVASRRLRDLLTRRLTGSNYPGLSISLRLTGSSAQEEASGVALGEAPDHSYESLRV
TSAQKHVLHVQLNRPNKRNAMNKVFWREMVECFNKISRDADCRAVVISGAGKMFTAGIDL
MDMASDILQPKGDDVARISWYLRDIITRYQETFNVIERCPKPVIAAVHGGCIGGGVDLVT
ACDIRYCAQDAFFQVKEVDVGLAADVGTLQRLPKVIGNQSLVNELAFTARKMMADEALGS
GLVSRVFPDKEVMLDAALALAAEISSKSPVAVQSTKVNLLYSRDHSVAESLNYVASWNMS
MLQTQDLVKSVQATTENKELKTVTFSKL
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggggatagtggcttctcgcagactccgcgacctactgacccggcgactgaca
ggctccaactacccgggactcagtattagccttcgcctcactggctcctctgcacaagag
gaggcttccggagtagccctcggtgaagccccagaccacagctatgagtcccttcgtgtg
acgtctgcgcagaaacatgttctgcatgtccagctcaaccggcccaacaagaggaatgcc
atgaacaaggtcttctggagagagatggtagagtgcttcaacaagatttcgagagacgct
gactgtcgggcggtggtgatctctggtgcaggaaaaatgttcactgcaggtattgacctg
atggacatggcttcggacatcctgcagcccaaaggagatgatgtggcccggatcagctgg
tacctccgtgacatcatcactcgataccaggagaccttcaacgtcatcgagaggtgcccc
aagcccgtgattgctgccgtccatgggggctgcattggcggaggtgtggaccttgtcacc
gcctgtgacatccggtactgtgcccaggatgctttcttccaggtgaaggaggtggacgtg
ggtttggctgccgatgtaggaacactgcagcgcctgcccaaggtcatcgggaaccagagc
ctggtcaacgagctggccttcaccgcccgcaagatgatggctgacgaggccctgggcagt
gggctggtcagccgggtgttcccagacaaagaggtcatgctggatgctgccttagcgctg
gcggccgagatttccagcaagagccccgtggcggtgcagagcaccaaggtcaacctgctg
tattcccgcgaccattcggtggccgagagcctcaactacgtggcgtcctggaacatgagc
atgctgcagacccaagacctcgtgaagtcggtccaggccacgactgagaacaaggaactg
aaaaccgtcaccttctccaagctctga

DBGET integrated database retrieval system