KEGG   Homo sapiens (human): 1893
Entry
1893              CDS       T01001                                 

Gene name
ECM1, URBWD
Definition
(RefSeq) extracellular matrix protein 1
  KO
K23867  extracellular matrix protein 1
Organism
hsa  Homo sapiens (human)
Disease
H00883  Lipoid proteinosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    1893 (ECM1)
SSDB
Motif
Pfam: ECM1 Serum_albumin
Other DBs
NCBI-GeneID: 1893
NCBI-ProteinID: NP_004416
OMIM: 602201
HGNC: 3153
Ensembl: ENSG00000143369
Vega: OTTHUMG00000012806
Pharos: Q16610(Tbio)
UniProt: Q16610 A0A140VJI7
Position
1q21.2
AA seq 540 aa
MGTTARAALVLTYLAVASAASEGGFTATGQRQLRPEHFQEVGYAAPPSPPLSRSLPMDHP
DSSQHGPPFEGQSQVQPPPSQEATPLQQEKLLPAQLPAEKEVGPPLPQEAVPLQKELPSL
QHPNEQKEGTPAPFGDQSHPEPESWNAAQHCQQDRSQGGWGHRLDGFPPGRPSPDNLNQI
CLPNRQHVVYGPWNLPQSSYSHLTRQGETLNFLEIGYSRCCHCRSHTNRLECAKLVWEEA
MSRFCEAEFSVKTRPHWCCTRQGEARFSCFQEEAPQPHYQLRACPSHQPDISSGLELPFP
PGVPTLDNIKNICHLRRFRSVPRNLPATDPLQRELLALIQLEREFQRCCRQGNNHTCTWK
AWEDTLDKYCDREYAVKTHHHLCCRHPPSPTRDECFARRAPYPNYDRDILTIDIGRVTPN
LMGHLCGNQRVLTKHKHIPGLIHNMTARCCDLPFPEQACCAEEEKLTFINDLCGPRRNIW
RDPALCCYLSPGDEQVNCFNINYLRNVALVSGDTENAKGQGEQGSTGGTNISSTSEPKEE
NT seq 1623 nt   +upstreamnt  +downstreamnt
atggggaccacagccagagcagccttggtcttgacctatttggctgttgcttctgctgcc
tctgagggaggcttcacggctacaggacagaggcagctgaggccagagcactttcaagaa
gttggctacgcagctcccccctccccacccctatcccgaagcctccccatggatcaccct
gactcctctcagcatggccctccctttgagggacagagtcaagtgcagccccctccctct
caggaggccacccctctccaacaggaaaagctgctacctgcccaactccctgctgaaaag
gaagtgggtccccctctccctcaggaagctgtccccctccaaaaagagctgccctctctc
cagcaccccaatgaacagaaggaaggaacgccagctccatttggggaccagagccatcca
gaacctgagtcctggaatgcagcccagcactgccaacaggaccggtcccaagggggctgg
ggccaccggctggatggcttcccccctgggcggccttctccagacaatctgaaccaaatc
tgccttcctaaccgtcagcatgtggtatatggtccctggaacctaccacagtccagctac
tcccacctcactcgccagggtgagaccctcaatttcctggagattggatattcccgctgc
tgccactgccgcagccacacaaaccgcctagagtgtgccaaacttgtgtgggaggaagca
atgagccgattctgtgaggccgagttctcggtcaagacccgaccccactggtgctgcacg
cggcagggggaggctcggttctcctgcttccaggaggaagctccccagccacactaccag
ctccgggcctgccccagccatcagcctgatatttcctcgggtcttgagctgcctttccct
cctggggtgcccacattggacaatatcaagaacatctgccacctgaggcgcttccgctct
gtgccacgcaacctgccagctactgaccccctacaaagggagctgctggcactgatccag
ctggagagggagttccagcgctgctgccgccaggggaacaatcacacctgtacatggaag
gcctgggaggatacccttgacaaatactgtgaccgggagtatgctgtgaagacccaccac
cacttgtgttgccgccaccctcccagccctactcgggatgagtgctttgcccgtcgggct
ccttaccccaactatgaccgggacatcttgaccattgacatcggtcgagtcacccccaac
ctcatgggccacctctgtggaaaccaaagagttctcaccaagcataaacatattcctggg
ctgatccacaacatgactgcccgctgctgtgacctgccatttccagaacaggcctgctgt
gcagaggaggagaaattaaccttcatcaatgatctgtgtggtccccgacgtaacatctgg
cgagaccctgccctctgctgttacctgagtcctggggatgaacaggtcaactgcttcaac
atcaattatctgaggaacgtggctctagtgtctggagacactgagaacgccaagggccag
ggggagcagggctcaactggaggaacaaatatcagctccacctctgagcccaaggaagaa
tga

DBGET integrated database retrieval system