KEGG   Homo sapiens (human): 1903Help
Entry
1903              CDS       T01001                                 

Gene name
S1PR3, EDG-3, EDG3, LPB3, S1P3
Definition
(RefSeq) sphingosine-1-phosphate receptor 3
  KO
K04290  sphingosine 1-phosphate receptor 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04071  Sphingolipid signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
Drug target
Amiselimod (DG02399): D10904 D10905
Etrasimod (DG02444): D10930
Ozanimod (DG02827): D10967 D10968
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    1903 (S1PR3)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1903 (S1PR3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    1903 (S1PR3)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Lipid
   Sphingolipid
    1903 (S1PR3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 Tetraspanin YoqO
Motif
Other DBs
NCBI-GeneID: 1903
NCBI-ProteinID: NP_005217
OMIM: 601965
HGNC: 3167
Ensembl: ENSG00000213694
Vega: OTTHUMG00000020173
Pharos: Q99500(Tclin)
UniProt: Q99500
Position
9q22.1
AA seq 378 aa AA seqDB search
MATALPPRLQPVRGNETLREHYQYVGKLAGRLKEASEGSTLTTVLFLVICSFIVLENLMV
LIAIWKNNKFHNRMYFFIGNLALCDLLAGIAYKVNILMSGKKTFSLSPTVWFLREGSMFV
ALGASTCSLLAIAIERHLTMIKMRPYDANKRHRVFLLIGMCWLIAFTLGALPILGWNCLH
NLPDCSTILPLYSKKYIAFCISIFTAILVTIVILYARIYFLVKSSSRKVANHNNSERSMA
LLRTVVIVVSVFIACWSPLFILFLIDVACRVQACPILFKAQWFIVLAVLNSAMNPVIYTL
ASKEMRRAFFRLVCNCLVRGRGARASPIQPALDPSRSKSSSSNNSSHSPKVKEDLPHTAP
SSCIMDKNAALQNGIFCN
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atggcaactgccctcccgccgcgtctccagccggtgcgggggaacgagaccctgcgggag
cattaccagtacgtggggaagttggcgggcaggctgaaggaggcctccgagggcagcacg
ctcaccaccgtgctcttcttggtcatctgcagcttcatcgtcttggagaacctgatggtt
ttgattgccatctggaaaaacaataaatttcacaaccgcatgtactttttcattggcaac
ctggctctctgcgacctgctggccggcatcgcttacaaggtcaacattctgatgtctggc
aagaagacgttcagcctgtctcccacggtctggttcctcagggagggcagtatgttcgtg
gcccttggggcgtccacctgcagcttactggccatcgccatcgagcggcacttgacaatg
atcaaaatgaggccttacgacgccaacaagaggcaccgcgtcttcctcctgatcgggatg
tgctggctcattgccttcacgctgggcgccctgcccattctgggctggaactgcctgcac
aatctccctgactgctctaccatcctgcccctctactccaagaagtacattgccttctgc
atcagcatcttcacggccatcctggtgaccatcgtgatcctctacgcacgcatctacttc
ctggtgaagtccagcagccgtaaggtggccaaccacaacaactcggagcggtccatggca
ctgctgcggaccgtggtgattgtggtgagcgtgttcatcgcctgctggtccccactcttc
atcctcttcctcattgatgtggcctgcagggtgcaggcgtgccccatcctcttcaaggct
cagtggttcatcgtgttggctgtgctcaactccgccatgaacccggtcatctacacgctg
gccagcaaggagatgcggcgggccttcttccgtctggtctgcaactgcctggtcagggga
cggggggcccgcgcctcacccatccagcctgcgctcgacccaagcagaagtaaatcaagc
agcagcaacaatagcagccactctccgaaggtcaaggaagacctgccccacacagccccc
tcatcctgcatcatggacaagaacgcagcacttcagaatgggatcttctgcaactga

DBGET integrated database retrieval system