KEGG   Homo sapiens (human): 1908Help
Entry
1908              CDS       T01001                                 

Gene name
EDN3, ET-3, ET3, HSCR4, PPET3, WS4B
Definition
(RefSeq) endothelin 3
  KO
K05227  endothelin-3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04270  Vascular smooth muscle contraction
hsa04924  Renin secretion
Disease
H00759  Waardenburg syndrome
H00910  Hirschsprung disease
H00916  Congenital central hypoventilation syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    1908 (EDN3)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1908 (EDN3)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    1908 (EDN3)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    1908 (EDN3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Endothelin
Motif
Other DBs
NCBI-GeneID: 1908
NCBI-ProteinID: NP_996917
OMIM: 131242
HGNC: 3178
Ensembl: ENSG00000124205
Vega: OTTHUMG00000032867
Pharos: P14138(Tbio)
CPD: C16013
UniProt: P14138
Structure
PDB: 

Position
20q13.32
AA seq 238 aa AA seqDB search
MEPGLWLLFGLTVTSAAGFVPCSQSGDAGRRGVSQAPTAARSEGDCEETVAGPGEETVAG
PGEGTVAPTALQGPSPGSPGQEQAAEGAPEHHRSRRCTCFTYKDKECVYYCHLDIIWINT
PEQTVPYGLSNYRGSFRGKRSAGPLPGNLQLSHRPHLRCACVGRYDKACLHFCTQTLDVS
SNSRTAEKTDKEEEGKVEVKDQQSKQALDLHHPKLMPGSGLALAPSTCPRCLFQEGAP
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atggagccggggctgtggctccttttcgggctcacagtgacctccgccgcaggattcgtg
ccttgctcccagtctggggatgctggcaggcgcggcgtgtcccaggcccccactgcagcc
agatctgagggggactgtgaagagactgtggctggccctggcgaggagactgtggctggc
cctggcgaggggactgtggccccgacagcactgcagggtccaagccctggaagccctggg
caggagcaggcggccgagggggcccctgagcaccaccgatccaggcgctgcacgtgcttc
acctacaaggacaaggagtgtgtctactattgccacctggacatcatttggatcaacact
cccgaacagacggtgccctatggactgtccaactacagaggaagcttccggggcaagagg
tctgcggggccacttccagggaatctgcagctctcacatcggccacacttgcgctgcgct
tgtgtggggagatatgacaaggcctgcctgcacttttgcacccaaactctggacgtcagc
agtaattcaaggacggcagaaaaaacagacaaagaagaggaagggaaggttgaagtcaag
gaccaacaaagcaagcaggctttagacctccaccatccaaagctcatgcccggcagtgga
ctcgccctcgctccatctacctgcccccgctgcctctttcaggaaggagccccttag

DBGET integrated database retrieval system