KEGG   Homo sapiens (human): 1909Help
Entry
1909              CDS       T01001                                 

Gene name
EDNRA, ET-A, ETA, ETA-R, ETAR, ETRA, MFDA, hET-AR
Definition
(RefSeq) endothelin receptor type A
  KO
K04197  endothelin receptor type A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04270  Vascular smooth muscle contraction
hsa04924  Renin secretion
hsa05200  Pathways in cancer
Drug target
Ambrisentan: D07077
Atrasentan hydrochloride: D03009
Bosentan (DG00266): D01227 D07538
Clazosentan sodium: D07682
Edonentan: D03953
Macitentan: D10135
Sitaxentan (DG00267): D07171 D08517
Zibotentan: D07741
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    1909 (EDNRA)
   04024 cAMP signaling pathway
    1909 (EDNRA)
   04022 cGMP - PKG signaling pathway
    1909 (EDNRA)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1909 (EDNRA)
 Organismal Systems
  Endocrine system
   04924 Renin secretion
    1909 (EDNRA)
  Circulatory system
   04270 Vascular smooth muscle contraction
    1909 (EDNRA)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    1909 (EDNRA)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Cardiovascular peptide
   Endothelin
    1909 (EDNRA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx DUF4149
Motif
Other DBs
NCBI-GeneID: 1909
NCBI-ProteinID: NP_001948
OMIM: 131243
HGNC: 3179
Ensembl: ENSG00000151617
Vega: OTTHUMG00000161354
Pharos: P25101(Tclin)
UniProt: P25101
Position
4q31.22-q31.23
AA seq 427 aa AA seqDB search
METLCLRASFWLALVGCVISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLP
SNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIA
SLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALS
VDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCM
LNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQ
RREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATM
NSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRS
SHKDSMN
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccctttgcctcagggcatccttttggctggcactggttggatgtgtaatcagt
gataatcctgagagatacagcacaaatctaagcaatcatgtggatgatttcaccactttt
cgtggcacagagctcagcttcctggttaccactcatcaacccactaatttggtcctaccc
agcaatggctcaatgcacaactattgcccacagcagactaaaattacttcagctttcaaa
tacattaacactgtgatatcttgtactattttcatcgtgggaatggtggggaatgcaact
ctgctcaggatcatttaccagaacaaatgtatgaggaatggccccaacgcgctgatagcc
agtcttgcccttggagaccttatctatgtggtcattgatctccctatcaatgtatttaag
ctgctggctgggcgctggccttttgatcacaatgactttggcgtatttctttgcaagctg
ttcccctttttgcagaagtcctcggtggggatcaccgtcctcaacctctgcgctcttagt
gttgacaggtacagagcagttgcctcctggagtcgtgttcagggaattgggattcctttg
gtaactgccattgaaattgtctccatctggatcctgtcctttatcctggccattcctgaa
gcgattggcttcgtcatggtaccctttgaatataggggtgaacagcataaaacctgtatg
ctcaatgccacatcaaaattcatggagttctaccaagatgtaaaggactggtggctcttc
gggttctatttctgtatgcccttggtgtgcactgcgatcttctacaccctcatgacttgt
gagatgttgaacagaaggaatggcagcttgagaattgccctcagtgaacatcttaagcag
cgtcgagaagtggcaaaaacagttttctgcttggttgtaatttttgctctttgctggttc
cctcttcatttaagccgtatattgaagaaaactgtgtataacgagatggacaagaaccga
tgtgaattacttagtttcttactgctcatggattacatcggtattaacttggcaaccatg
aattcatgtataaaccccatagctctgtattttgtgagcaagaaatttaaaaattgtttc
cagtcatgcctctgctgctgctgttaccagtccaaaagtctgatgacctcggtccccatg
aacggaacaagcatccagtggaagaaccacgatcaaaacaaccacaacacagaccggagc
agccataaggacagcatgaactga

DBGET integrated database retrieval system