KEGG   Homo sapiens (human): 1915Help
Entry
1915              CDS       T01001                                 

Gene name
EEF1A1, CCS-3, CCS3, EE1A1, EEF-1, EEF1A, EF-Tu, EF1A, GRAF-1EF, HNGC:16303, LENG7, PTI1, eEF1A-1
Definition
(RefSeq) eukaryotic translation elongation factor 1 alpha 1
  KO
K03231  elongation factor 1-alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  RNA transport
hsa05134  Legionellosis
hsa05140  Leishmaniasis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    1915 (EEF1A1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    1915 (EEF1A1)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    1915 (EEF1A1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    1915 (EEF1A1)
   03016 Transfer RNA biogenesis [BR:hsa03016]
    1915 (EEF1A1)
   03012 Translation factors [BR:hsa03012]
    1915 (EEF1A1)
   04131 Membrane trafficking [BR:hsa04131]
    1915 (EEF1A1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    1915 (EEF1A1)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Trans-acting binding proteins
     1915 (EEF1A1)
Transfer RNA biogenesis [BR:hsa03016]
 Eukaryotic type
  tRNA transport factors
   tRNA export factors
    1915 (EEF1A1)
Translation factors [BR:hsa03012]
 Eukaryotic type
  Elongation factors
   1915 (EEF1A1)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Other CMA associated proteins
    1915 (EEF1A1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   1915 (EEF1A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 GTP_EFTU_D4 G-alpha
Motif
Other DBs
NCBI-GeneID: 1915
NCBI-ProteinID: NP_001393
OMIM: 130590
HGNC: 3189
Ensembl: ENSG00000156508
Vega: OTTHUMG00000015031
Pharos: P68104(Tbio)
UniProt: P68104 Q6IPS9
Position
6q13
AA seq 462 aa AA seqDB search
MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL
DKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV
GEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKK
IGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTR
PTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPVNVTTEVKSVEMHHEALS
EALPGDNVGFNVKNVSVKDVRRGNVAGDSKNDPPMEAAGFTAQVIILNHPGQISAGYAPV
LDCHTAHIACKFAELKEKIDRRSGKKLEDGPKFLKSGDAAIVDMVPGKPMCVESFSDYPP
LGRFAVRDMRQTVAVGVIKAVDKKAAGAGKVTKSAQKAQKAK
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaggaaaagactcatatcaacattgtcgtcattggacacgtagattcgggcaag
tccaccactactggccatctgatctataaatgcggtggcatcgacaaaagaaccattgaa
aaatttgagaaggaggctgctgagatgggaaagggctccttcaagtatgcctgggtcttg
gataaactgaaagctgagcgtgaacgtggtatcaccattgatatctccttgtggaaattt
gagaccagcaagtactatgtgactatcattgatgccccaggacacagagactttatcaaa
aacatgattacagggacatctcaggctgactgtgctgtcctgattgttgctgctggtgtt
ggtgaatttgaagctggtatctccaagaatgggcagacccgagagcatgcccttctggct
tacacactgggtgtgaaacaactaattgtcggtgttaacaaaatggattccactgagcca
ccctacagccagaagagatatgaggaaattgttaaggaagtcagcacttacattaagaaa
attggctacaaccccgacacagtagcatttgtgccaatttctggttggaatggtgacaac
atgctggagccaagtgctaacatgccttggttcaagggatggaaagtcacccgtaaggat
ggcaatgccagtggaaccacgctgcttgaggctctggactgcatcctaccaccaactcgt
ccaactgacaagcccttgcgcctgcctctccaggatgtctacaaaattggtggtattggt
actgttcctgttggccgagtggagactggtgttctcaaacccggtatggtggtcaccttt
gctccagtcaacgttacaacggaagtaaaatctgtcgaaatgcaccatgaagctttgagt
gaagctcttcctggggacaatgtgggcttcaatgtcaagaatgtgtctgtcaaggatgtt
cgtcgtggcaacgttgctggtgacagcaaaaatgacccaccaatggaagcagctggcttc
actgctcaggtgattatcctgaaccatccaggccaaataagcgccggctatgcccctgta
ttggattgccacacggctcacattgcatgcaagtttgctgagctgaaggaaaagattgat
cgccgttctggtaaaaagctggaagatggccctaaattcttgaagtctggtgatgctgcc
attgttgatatggttcctggcaagcccatgtgtgttgagagcttctcagactatccacct
ttgggtcgctttgctgttcgtgatatgagacagacagttgcggtgggtgtcatcaaagca
gtggacaagaaggctgctggagctggcaaggtcaccaagtctgcccagaaagctcagaag
gctaaatga

KEGG   Homo sapiens (human): 1917Help
Entry
1917              CDS       T01001                                 

Gene name
EEF1A2, EEF1AL, EF-1-alpha-2, EF1A, EIEE33, HS1, MRD38, STN, STNL
Definition
(RefSeq) eukaryotic translation elongation factor 1 alpha 2
  KO
K03231  elongation factor 1-alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  RNA transport
hsa05134  Legionellosis
hsa05140  Leishmaniasis
Disease
H00606  Early infantile epileptic encephalopathy
H00773  Autosomal dominant mental retardation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    1917 (EEF1A2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    1917 (EEF1A2)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    1917 (EEF1A2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    1917 (EEF1A2)
   03016 Transfer RNA biogenesis [BR:hsa03016]
    1917 (EEF1A2)
   03012 Translation factors [BR:hsa03012]
    1917 (EEF1A2)
   04131 Membrane trafficking [BR:hsa04131]
    1917 (EEF1A2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    1917 (EEF1A2)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Trans-acting binding proteins
     1917 (EEF1A2)
Transfer RNA biogenesis [BR:hsa03016]
 Eukaryotic type
  tRNA transport factors
   tRNA export factors
    1917 (EEF1A2)
Translation factors [BR:hsa03012]
 Eukaryotic type
  Elongation factors
   1917 (EEF1A2)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Other CMA associated proteins
    1917 (EEF1A2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   1917 (EEF1A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 GTP_EFTU_D4 G-alpha
Motif
Other DBs
NCBI-GeneID: 1917
NCBI-ProteinID: NP_001949
OMIM: 602959
HGNC: 3192
Ensembl: ENSG00000101210
Vega: OTTHUMG00000033076
Pharos: Q05639(Tbio)
UniProt: Q05639
Position
20q13.33
AA seq 463 aa AA seqDB search
MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL
DKLKAERERGITIDISLWKFETTKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV
GEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPAYSEKRYDEIVKEVSAYIKK
IGYNPATVPFVPISGWHGDNMLEPSPNMPWFKGWKVERKEGNASGVSLLEALDTILPPTR
PTDKPLRLPLQDVYKIGGIGTVPVGRVETGILRPGMVVTFAPVNITTEVKSVEMHHEALS
EALPGDNVGFNVKNVSVKDIRRGNVCGDSKSDPPQEAAQFTSQVIILNHPGQISAGYSPV
IDCHTAHIACKFAELKEKIDRRSGKKLEDNPKSLKSGDAAIVEMVPGKPMCVESFSQYPP
LGRFAVRDMRQTVAVGVIKNVEKKSGGAGKVTKSAQKAQKAGK
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaggagaagacccacatcaacatcgtggtcatcggccacgtggactccggaaag
tccaccaccacgggccacctcatctacaaatgcggaggtattgacaaaaggaccattgag
aagttcgagaaggaggcggctgagatggggaagggatccttcaagtatgcctgggtgctg
gacaagctgaaggcggagcgtgagcgcggcatcaccatcgacatctccctctggaagttc
gagaccaccaagtactacatcaccatcatcgatgcccccggccaccgcgacttcatcaag
aacatgatcacgggtacatcccaggcggactgcgcagtgctgatcgtggcggcgggcgtg
ggcgagttcgaggcgggcatctccaagaatgggcagacgcgggagcatgccctgctggcc
tacacgctgggtgtgaagcagctcatcgtgggcgtgaacaaaatggactccacagagccg
gcctacagcgagaagcgctacgacgagatcgtcaaggaagtcagcgcctacatcaagaag
atcggctacaacccggccaccgtgccctttgtgcccatctccggctggcacggtgacaac
atgctggagccctcccccaacatgccgtggttcaagggctggaaggtggagcgtaaggag
ggcaacgcaagcggcgtgtccctgctggaggccctggacaccatcctgccccccacgcgc
cccacggacaagcccctgcgcctgccgctgcaggacgtgtacaagattggcggcattggc
acggtgcccgtgggccgggtggagaccggcatcctgcggccgggcatggtggtgaccttt
gcgccagtgaacatcaccactgaggtgaagtcagtggagatgcaccacgaggctctgagc
gaagctctgcccggcgacaacgtcggcttcaatgtgaagaacgtgtcggtgaaggacatc
cggcggggcaacgtgtgtggggacagcaagtctgacccgccgcaggaggctgctcagttc
acctcccaggtcatcatcctgaaccacccggggcagattagcgccggctactccccggtc
atcgactgccacacagcccacatcgcctgcaagtttgcggagctgaaggagaagattgac
cggcgctctggcaagaagctggaggacaaccccaagtccctgaagtctggagacgcggcc
atcgtggagatggtgccgggaaagcccatgtgtgtggagagcttctcccagtacccgcct
ctcggccgcttcgccgtgcgcgacatgaggcagacggtggccgtaggcgtcatcaagaac
gtggagaagaagagcggcggcgccggcaaggtcaccaagtcggcgcagaaggcgcagaag
gcgggcaagtga

DBGET integrated database retrieval system