KEGG   Homo sapiens (human): 1933
Entry
1933              CDS       T01001                                 

Gene name
EEF1B2, EEF1B, EEF1B1, EF1B
Definition
(RefSeq) eukaryotic translation elongation factor 1 beta 2
  KO
K03232  elongation factor 1-beta
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:hsa03012]
    1933 (EEF1B2)
Translation factors [BR:hsa03012]
 Eukaryotic type
  Elongation factors
   1933 (EEF1B2)
SSDB
Motif
Pfam: EF1_GNE EF-1_beta_acid GST_C_3 GST_C_6
Other DBs
NCBI-GeneID: 1933
NCBI-ProteinID: NP_001032752
OMIM: 600655
HGNC: 3208
Ensembl: ENSG00000114942
Pharos: P24534(Tbio)
UniProt: P24534 A0A024R3W7
Structure
PDB: 
5DQS 1B64

Position
2q33.3
AA seq 225 aa
MGFGDLKSPAGLQVLNDYLADKSYIEGYVPSQADVAVFEAVSSPPPADLCHALRWYNHIK
SYEKEKASLPGVKKALGKYGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAKRLRE
ERLAQYESKKAKKPALVAKSSILLDVKPWDDETDMAKLEECVRSIQADGLVWGSSKLVPV
GYGIKKLQIQCVVEDDKVGTDMLEEQITAFEDYVQSMDVAAFNKI
NT seq 678 nt   +upstreamnt  +downstreamnt
atgggtttcggagacctgaaaagccctgccggcctccaggtgctcaacgattacctggcg
gacaagagctacatcgaggggtatgtgccatcacaagcagatgtggcagtatttgaagcc
gtgtccagcccaccgcctgccgacttgtgtcatgccctacgttggtataatcacatcaag
tcttacgaaaaggaaaaggccagcctgccaggagtgaagaaagctttgggcaaatatggt
cctgccgatgtggaagacactacaggaagtggagctacagatagtaaagatgatgatgac
attgacctctttggatctgatgatgaggaggaaagtgaagaagcaaagaggctaagggaa
gaacgtcttgcacaatatgaatcaaagaaagccaaaaaacctgcacttgttgccaagtct
tccatcttactagatgtgaaaccttgggatgatgagacagatatggcgaaattagaggag
tgcgtcagaagcattcaagcagacggcttagtctggggctcatctaaactagttccagtg
ggatacggaattaagaaacttcaaatacagtgtgtagttgaagatgataaagttggaaca
gatatgctggaggagcagatcactgcttttgaggactatgtgcagtccatggatgtggct
gctttcaacaagatctaa

DBGET integrated database retrieval system