KEGG   Homo sapiens (human): 1936Help
Entry
1936              CDS       T01001                                 

Gene name
EEF1D, EF-1D, EF1D, FP1047
Definition
(RefSeq) eukaryotic translation elongation factor 1 delta
  KO
K15410  elongation factor 1-delta
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:hsa03012]
    1936 (EEF1D)
Translation factors [BR:hsa03012]
 Eukaryotic type
  Elongation factors
   1936 (EEF1D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF1_GNE EF-1_beta_acid Striatin CCD48 TolA_bind_tri JIP_LZII MinC_N Trimer_CC SlyX KASH_CCD
Motif
Other DBs
NCBI-GeneID: 1936
NCBI-ProteinID: NP_001123527
OMIM: 130592
HGNC: 3211
Ensembl: ENSG00000104529
Vega: OTTHUMG00000165191
Pharos: P29692(Tbio)
UniProt: P29692
Structure
PDB: 

Position
8q24.3
AA seq 281 aa AA seqDB search
MATNFLAHEKIWFDKFKYDDAERRFYEQMNGPVAGASRQENGASVILRDIARARENIQKS
LAGSSGPGASSGTSGDHGELVVRIASLEVENQSLRGVVQELQQAISKLEARLNVLEKSSP
GHRATAPQTQHVSPMRQVEPPAKKPATPAEDDEDDDIDLFGSDNEEEDKEAAQLREERLR
QYAEKKAKKPALVAKSSILLDVKPWDDETDMAQLEACVRSIQLDGLVWGASKLVPVGYGI
RKLQIQCVVEDDKVGTDLLEEEITKFEEHVQSVDIAAFNKI
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atggctacaaacttcctagcacatgagaagatctggttcgacaagttcaaatatgacgac
gcagaaaggagattctacgagcagatgaacgggcctgtggcaggtgcctcccgccaggag
aacggcgccagcgtgatcctccgtgacattgcgagagccagagagaacatccagaaatcc
ctggctggaagctcaggccccggggcctccagcggcaccagcggagaccacggtgagctc
gtcgtccggattgccagtctggaagtggagaaccagagtctgcgtggcgtggtacaggag
ctgcagcaggccatctccaagctggaggcccggctgaacgtgctggagaagagctcgcct
ggccaccgggccacggccccacagacccagcacgtatctcccatgcgccaagtggagccc
ccagccaagaagccagccacaccagcagaggatgacgaggatgatgacattgacctgttt
ggcagtgacaatgaggaggaggacaaggaggcggcacagctgcgggaggagcggctacgg
cagtacgcggagaagaaggccaagaagcctgcactggtggccaagtcctccatcctgctg
gatgtcaagccttgggatgatgagacggacatggcccagctggaggcctgtgtgcgctct
atccagctggacgggctggtctggggggcttccaagctggtgcccgtgggctacggtatc
cggaagctacagattcagtgtgtggtggaggacgacaaggtggggacagacttgctggag
gaggagatcaccaagtttgaggagcacgtgcagagtgtcgatatcgcagctttcaacaag
atctga

DBGET integrated database retrieval system