KEGG   Homo sapiens (human): 1944
Entry
1944              CDS       T01001                                 

Symbol
EFNA3, EFL2, EPLG3, Ehk1-L, LERK3
Name
(RefSeq) ephrin A3
  KO
K05462  ephrin-A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04360  Axon guidance
hsa05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    1944 (EFNA3)
   04014 Ras signaling pathway
    1944 (EFNA3)
   04015 Rap1 signaling pathway
    1944 (EFNA3)
   04151 PI3K-Akt signaling pathway
    1944 (EFNA3)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    1944 (EFNA3)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    1944 (EFNA3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    1944 (EFNA3)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    1944 (EFNA3)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    1944 (EFNA3)
Cytokines and growth factors [BR:hsa04052]
 Growth factors
  Growth factors (RTK binding)
   1944 (EFNA3)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Axon guidance molecules
   1944 (EFNA3)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Others
  1944 (EFNA3)
SSDB
Motif
Pfam: Ephrin
Other DBs
NCBI-GeneID: 1944
NCBI-ProteinID: NP_004943
OMIM: 601381
HGNC: 3223
Ensembl: ENSG00000143590
Vega: OTTHUMG00000035313
Pharos: P52797(Tbio)
UniProt: P52797
Position
1:155078837..155087538
AA seq 238 aa
MAAAPLLLLLLLVPVPLLPLLAQGPGGALGNRHAVYWNSSNQHLRREGYTVQVNVNDYLD
IYCPHYNSSGVGPGAGPGPGGGAEQYVLYMVSRNGYRTCNASQGFKRWECNRPHAPHSPI
KFSEKFQRYSAFSLGYEFHAGHEYYYISTPTHNLHWKCLRMKVFVCCASTSHSGEKPVPT
LPQFTMGPNVKINVLEDFEGENPQVPKLEKSISGTSPKREHLPLAVGIAFFLMTFLAS
NT seq 717 nt   +upstreamnt  +downstreamnt
atggcggcggctccgctgctgctgctgctgctgctcgtgcccgtgccgctgctgccgctg
ctggcccaagggcccggaggggcgctgggaaaccggcatgcggtgtactggaacagctcc
aaccagcacctgcggcgagagggctacaccgtgcaggtgaacgtgaacgactatctggat
atttactgcccgcactacaacagctcgggggtgggccccggggcgggaccggggcccgga
ggcggggcagagcagtacgtgctgtacatggtgagccgcaacggctaccgcacctgcaac
gccagccagggcttcaagcgctgggagtgcaaccggccgcacgccccgcacagccccatc
aagttctcggagaagttccagcgctacagcgccttctctctgggctacgagttccacgcc
ggccacgagtactactacatctccacgcccactcacaacctgcactggaagtgtctgagg
atgaaggtgttcgtctgctgcgcctccacatcgcactccggggagaagccggtccccact
ctcccccagttcaccatgggccccaatgtgaagatcaacgtgctggaagactttgaggga
gagaaccctcaggtgcccaagcttgagaagagcatcagcgggaccagccccaaacgggaa
cacctgcccctggccgtgggcatcgccttcttcctcatgacgttcttggcctcctag

DBGET integrated database retrieval system