KEGG   Homo sapiens (human): 1945Help
Entry
1945              CDS       T01001                                 

Gene name
EFNA4, EFL4, EPLG4, LERK4
Definition
(RefSeq) ephrin A4
  KO
K05462  ephrin-A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    1945 (EFNA4)
   04015 Rap1 signaling pathway
    1945 (EFNA4)
   04010 MAPK signaling pathway
    1945 (EFNA4)
   04151 PI3K-Akt signaling pathway
    1945 (EFNA4)
 09150 Organismal Systems
  09158 Development
   04360 Axon guidance
    1945 (EFNA4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    1945 (EFNA4)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    1945 (EFNA4)
Cytokines and growth factors [BR:hsa04052]
 Growth factors
  Growth factors (RTK binding)
   1945 (EFNA4)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Axon guidance molecules
   1945 (EFNA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ephrin
Motif
Other DBs
NCBI-GeneID: 1945
NCBI-ProteinID: NP_005218
OMIM: 601380
HGNC: 3224
Ensembl: ENSG00000243364
Vega: OTTHUMG00000035309
Pharos: P52798(Tbio)
UniProt: P52798
Position
1q21.3
AA seq 201 aa AA seqDB search
MRLLPLLRTVLWAAFLGSPLRGGSSLRHVVYWNSSNPRLLRGDAVVELGLNDYLDIVCPH
YEGPGPPEGPETFALYMVDWPGYESCQAEGPRAYKRWVCSLPFGHVQFSEKIQRFTPFSL
GFEFLPGETYYYISVPTPESSGQCLRLQVSVCCKERKSESAHPVGSPGESGTSGWRGGDT
PSPLCLLLLLLLLILRLLRIL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcggctgctgcccctgctgcggactgtcctctgggccgcgttcctcggctcccctctg
cgcgggggctccagcctccgccacgtagtctactggaactccagtaaccccaggttgctt
cgaggagacgccgtggtggagctgggcctcaacgattacctagacattgtctgcccccac
tacgaaggcccagggccccctgagggccccgagacgtttgctttgtacatggtggactgg
ccaggctatgagtcctgccaggcagagggcccccgggcctacaagcgctgggtgtgctcc
ctgccctttggccatgttcaattctcagagaagattcagcgcttcacacccttctccctc
ggctttgagttcttacctggagagacttactactacatctcggtgcccactccagagagt
tctggccagtgcttgaggctccaggtgtctgtctgctgcaaggagaggaagtctgagtca
gcccatcctgttgggagccctggagagagtggcacatcagggtggcgagggggggacact
cccagccccctctgtctcttgctattactgctgcttctgattcttcgtcttctgcgaatt
ctgtga

DBGET integrated database retrieval system