KEGG   Homo sapiens (human): 1946Help
Entry
1946              CDS       T01001                                 

Gene name
EFNA5, AF1, EFL5, EPLG7, GLC1M, LERK7, RAGS
Definition
(RefSeq) ephrin A5
  KO
K05462  ephrin-A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    1946 (EFNA5)
   04015 Rap1 signaling pathway
    1946 (EFNA5)
   04010 MAPK signaling pathway
    1946 (EFNA5)
   04151 PI3K-Akt signaling pathway
    1946 (EFNA5)
 09150 Organismal Systems
  09158 Development
   04360 Axon guidance
    1946 (EFNA5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    1946 (EFNA5)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    1946 (EFNA5)
Cytokines and growth factors [BR:hsa04052]
 Growth factors
  Growth factors (RTK binding)
   1946 (EFNA5)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Axon guidance molecules
   1946 (EFNA5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ephrin
Motif
Other DBs
NCBI-GeneID: 1946
NCBI-ProteinID: NP_001953
OMIM: 601535
HGNC: 3225
Ensembl: ENSG00000184349
Vega: OTTHUMG00000128741
Pharos: P52803(Tbio)
UniProt: P52803
Structure
PDB: 

Position
5q21.3
AA seq 228 aa AA seqDB search
MLHVEMLTLVFLVLWMCVFSQDPGSKAVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDV
FCPHYEDSVPEDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQL
FTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDK
VENSLEPADDTVHESAEPSRGENAAQTPRIPSRLLAILLFLLAMLLTL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgttgcacgtggagatgttgacgctggtgtttctggtgctctggatgtgtgtgttcagc
caggacccgggctccaaggccgtcgccgaccgctacgctgtctactggaacagcagcaac
cccagattccagaggggtgactaccatattgatgtctgtatcaatgactacctggatgtt
ttctgccctcactatgaggactccgtcccagaagataagactgagcgctatgtcctctac
atggtgaactttgatggctacagtgcctgcgaccacacttccaaagggttcaagagatgg
gaatgtaaccggcctcactctccaaatggaccgctgaagttctctgaaaaattccagctc
ttcactcccttttctctaggatttgaattcaggccaggccgagaatatttctacatctcc
tctgcaatcccagataatggaagaaggtcctgtctaaagctcaaagtctttgtgagacca
acaaatagctgtatgaaaactataggtgttcatgatcgtgttttcgatgttaacgacaaa
gtagaaaattcattagaaccagcagatgacaccgtacatgagtcagccgagccatcccgc
ggcgagaacgcggcacaaacaccaaggatacccagccgccttttggcaatcctactgttc
ctcctggcgatgcttttgacattatag

DBGET integrated database retrieval system