KEGG   Homo sapiens (human): 1948Help
Entry
1948              CDS       T01001                                 

Gene name
EFNB2, EPLG5, HTKL, Htk-L, LERK5
Definition
(RefSeq) ephrin B2
  KO
K05463  ephrin-B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development
   04360 Axon guidance
    1948 (EFNB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    1948 (EFNB2)
   04052 Cytokines and growth factors [BR:hsa04052]
    1948 (EFNB2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   1948 (EFNB2)
Cytokines and growth factors [BR:hsa04052]
 Growth factors
  Growth factors (RTK binding)
   1948 (EFNB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ephrin TMEM132D_C EphA2_TM RIFIN ECSCR TMEM154 DUF4381
Motif
Other DBs
NCBI-GeneID: 1948
NCBI-ProteinID: NP_004084
OMIM: 600527
HGNC: 3227
Ensembl: ENSG00000125266
Vega: OTTHUMG00000017324
Pharos: P52799(Tbio)
UniProt: P52799
Structure
PDB: 

Position
13q33.3
AA seq 333 aa AA seqDB search
MAVRRDSVWKYCWGVLMVLCRTAISKSIVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDI
ICPKVDSKTVGQYEYYKVYMVDKDQADRCTIKKENTPLLNCAKPDQDIKFTIKFQEFSPN
LWGLEFQKNKDYYIISTSNGSLEGLDNQEGGVCQTRAMKILMKVGQDASSAGSTRNKDPT
RRPELEAGTNGRSSTTSPFVKPNPGSSTDGNSAGHSGNNILGSEVALFAGIASGCIIFIV
IIITLVVLLLKYRRRHRKHSPQHTTTLSLSTLATPKRSGNNNGSEPSDIIIPLRTADSVF
CPHYEKVSGDYGHPVYIVQEMPPQSPANIYYKV
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atggctgtgagaagggactccgtgtggaagtactgctggggtgttttgatggttttatgc
agaactgcgatttccaaatcgatagttttagagcctatctattggaattcctcgaactcc
aaatttctacctggacaaggactggtactatacccacagataggagacaaattggatatt
atttgccccaaagtggactctaaaactgttggccagtatgaatattataaagtttatatg
gttgataaagaccaagcagacagatgcactattaagaaggaaaatacccctctcctcaac
tgtgccaaaccagaccaagatatcaaattcaccatcaagtttcaagaattcagccctaac
ctctggggtctagaatttcagaagaacaaagattattacattatatctacatcaaatggg
tctttggagggcctggataaccaggagggaggggtgtgccagacaagagccatgaagatc
ctcatgaaagttggacaagatgcaagttctgctggatcaaccaggaataaagatccaaca
agacgtccagaactagaagctggtacaaatggaagaagttcgacaacaagtccctttgta
aaaccaaatccaggttctagcacagacggcaacagcgccggacattcggggaacaacatc
ctcggttccgaagtggccttatttgcagggattgcttcaggatgcatcatcttcatcgtc
atcatcatcacgctggtggtcctcttgctgaagtaccggaggagacacaggaagcactcg
ccgcagcacacgaccacgctgtcgctcagcacactggccacacccaagcgcagcggcaac
aacaacggctcagagcccagtgacattatcatcccgctaaggactgcggacagcgtcttc
tgccctcactacgagaaggtcagcggggactacgggcacccggtgtacatcgtccaggag
atgcccccgcagagcccggcgaacatttactacaaggtctga

DBGET integrated database retrieval system