KEGG   Homo sapiens (human): 196051
Entry
196051            CDS       T01001                                 

Gene name
PLPP4, DPPL2, PPAPDC1, PPAPDC1A
Definition
(RefSeq) phospholipid phosphatase 4
  KO
K18693  diacylglycerol diphosphate phosphatase / phosphatidate phosphatase [EC:3.1.3.81 3.1.3.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00561  Glycerolipid metabolism
hsa00564  Glycerophospholipid metabolism
Module
hsa_M00089  Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    196051 (PLPP4)
   00564 Glycerophospholipid metabolism
    196051 (PLPP4)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.4  phosphatidate phosphatase
     196051 (PLPP4)
    3.1.3.81  diacylglycerol diphosphate phosphatase
     196051 (PLPP4)
SSDB
Motif
Pfam: PAP2 DUF975
Other DBs
NCBI-GeneID: 196051
NCBI-ProteinID: NP_001025230
HGNC: 23531
Ensembl: ENSG00000203805
Vega: OTTHUMG00000019168
Pharos: Q5VZY2(Tbio)
UniProt: Q5VZY2
Position
10q26.12
AA seq 271 aa
MRELAIEIGVRALLFGVFVFTEFLDPFQRVIQPEEIWLYKNPLVQSDNIPTRLMFAISFL
TPLAVICVVKIIRRTDKTEIKEAFLAVSLALALNGVCTNTIKLIVGRPRPDFFYRCFPDG
VMNSEMHCTGDPDLVSEGRKSFPSIHSSFAFSGLGFTTFYLAGKLHCFTESGRGKSWRLC
AAILPLYCAMMIALSRMCDYKHHWQDSFVGGVIGLIFAYICYRQHYPPLANTACHKPYVS
LRVPASLKKEERPTADSAPSLPLEGITEGPV
NT seq 816 nt   +upstreamnt  +downstreamnt
atgcgggagctggccattgagatcggggtgcgagccctgctcttcggagtcttcgttttt
acagagtttttggatccgttccagagagtcatccagccagaagagatctggctctataaa
aatcctttggtgcaatcagataacatacctacccgcctcatgtttgcaatttctttcctc
acacccctggctgttatttgtgtggtgaaaattatccggcgaacagacaagactgaaatt
aaggaagccttcttagcggtgtccttggctcttgctttgaatggagtctgcacaaacact
attaaattaatagtgggaagacctcgccccgatttcttttaccgctgctttccagatgga
gtgatgaactcggaaatgcattgcacaggtgaccccgatctggtgtccgagggccgcaaa
agcttccccagcatccattcctcctttgccttttcgggccttggcttcacgacgttctac
ttggcgggcaagctgcactgcttcaccgagagtgggcggggaaagagctggcggctctgt
gctgccatcctgcccttgtactgcgccatgatgattgccctgtcccgcatgtgcgactac
aagcatcactggcaagattcctttgtgggtggagtcatcggcctcatttttgcatacatt
tgctacagacagcactatcctcctctggccaacacagcttgccataaaccctacgttagt
ctgcgagtcccagcctcactgaagaaagaggagaggcccacagctgacagcgcacccagc
ttgcctctggaggggatcaccgaaggcccggtatga

DBGET integrated database retrieval system