KEGG   Homo sapiens (human): 196074
Entry
196074            CDS       T01001                                 

Gene name
METTL15, METT5D1
Definition
(RefSeq) methyltransferase like 15
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Methyltransf_5 Methyltr_RsmB-F Methyltransf_25
Other DBs
NCBI-GeneID: 196074
NCBI-ProteinID: NP_001107000
OMIM: 618711
HGNC: 26606
Ensembl: ENSG00000169519
Vega: OTTHUMG00000150448
Pharos: A6NJ78(Tdark)
UniProt: A6NJ78
Position
11p14.1
AA seq 407 aa
MLRYPYFCRMYKECLSCWLESGIPNLGVWPNRIHTTAEKYREYEAREQTDQTQAQELHRS
QDRDFETMAKLHIPVMVDEVVHCLSPQKGQIFLDMTFGSGGHTKAILQKESDIVLYALDR
DPTAYALAEHLSELYPKQIRAMLGQFSQAEALLMKAGVQPGTFDGVLMDLGCSSMQLDTP
ERGFSLRKDGPLDMRMDGGRYPDMPTAADVVNALDQQALASILRTYGEEKHAKKIASAIV
QARSIYPITRTQQLASIVAGAFPPSAIYTRKDLLQRSTHIATKTFQALRIFVNNELNELY
TGLKTAQKFLRPGGRLVALSFHSLEDRIVKRFLLGISMTERFNLSVRQQVMKTSQLGSDH
ENTEEVSMRRAPLMWELIHKKVLSPQDQDVQDNPRGRSAKLRAAIKL
NT seq 1224 nt   +upstreamnt  +downstreamnt
atgcttcggtatccatatttttgtagaatgtataaagaatgcctttcatgttggttggaa
tctggcatacctaatttaggtgtctggccaaacagaatacatactacagcagaaaaatat
agagaatatgaagcccgggagcaaacagatcaaactcaagcccaggagttacacagatct
caagatagagattttgaaactatggctaaattacatattccagtaatggtggatgaagtt
gttcattgtttgtcaccacaaaaaggacagatttttctagatatgacatttggttcggga
gggcacacaaaagccattctgcagaaggagtcagatattgttctctatgccttggacaga
gacccaacagcttatgcattagctgaacatctttcagagttgtatcctaaacaaatccga
gctatgctgggccagttcagccaggcagaagccttattaatgaaagctggagtgcagcca
ggaacttttgatggagttcttatggatcttgggtgttcctccatgcaacttgatactcct
gaaagaggtttttcccttcggaaagatggccctttggacatgagaatggatggtggcagg
taccctgacatgcccactgctgctgatgttgtgaatgctttagatcaacaggcacttgca
tctatcctaagaacatacggggaggagaagcatgccaagaaaatcgcttcagcaattgtt
caggcacgcagcatctaccccatcaccagaacccagcagcttgccagcatcgttgcagga
gcatttcctccctctgctatttatacacggaaagacttactacagcgatctacccatatt
gccaccaagactttccaggctcttcgcatatttgtgaacaatgagctcaatgaactctac
acgggactgaagacagctcagaagtttctgagacctggtggtcgtcttgttgccctctcc
ttccattcactagaggatcgcatcgtcaaaagatttttgcttggaataagcatgacagaa
agatttaacctaagtgttagacaacaagtgatgaaaacatctcaattgggttcagatcac
gaaaacacggaagaagtctctatgagaagagctcctttaatgtgggaattgatacacaag
aaggtacttagtccacaagatcaggatgtacaagataaccccagagggcgctcagccaag
cttagagcagctatcaaattataa

DBGET integrated database retrieval system