KEGG   Homo sapiens (human): 196463
Entry
196463            CDS       T01001                                 
Symbol
PLBD2, P76
Name
(RefSeq) phospholipase B domain containing 2
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Phospholip_B
Other DBs
NCBI-GeneID: 196463
NCBI-ProteinID: NP_775813
HGNC: 27283
Ensembl: ENSG00000151176
Vega: OTTHUMG00000169567
Pharos: Q8NHP8(Tbio)
UniProt: Q8NHP8
Position
12:113358587..113391629
AA seq 589 aa
MVGQMYCYPGSHLARALTRALALALVLALLVGPFLSGLAGAIPAPGGRWARDGQVPPASR
SRSVLLDVSAGQLLMVDGRHPDAVAWANLTNAIRETGWAFLELGTSGQYNDSLQAYAAGV
VEAAVSEELIYMHWMNTVVNYCGPFEYEVGYCERLKSFLEANLEWMQEEMESNPDSPYWH
QVRLTLLQLKGLEDSYEGRVSFPAGKFTIKPLGFLLLQLSGDLEDLELALNKTKIKPSLG
SGSCSALIKLLPGQSDLLVAHNTWNNYQHMLRVIKKYWLQFREGPWGDYPLVPGNKLVFS
SYPGTIFSCDDFYILGSGLVTLETTIGNKNPALWKYVRPRGCVLEWVRNIVANRLASDGA
TWADIFKRFNSGTYNNQWMIVDYKAFIPGGPSPGSRVLTILEQIPGMVVVADKTSELYQK
TYWASYNIPSFETVFNASGLQALVAQYGDWFSYDGSPRAQIFRRNQSLVQDMDSMVRLMR
YNDFLHDPLSLCKACNPQPNGENAISARSDLNPANGSYPFQALRQRSHGGIDVKVTSMSL
ARILSLLAASGPTWDQVPPFQWSTSPFSGLLHMGQPDLWKFAPVKVSWD
NT seq 1770 nt   +upstreamnt  +downstreamnt
atggtgggccagatgtactgctaccccggcagccacctggcccgggcgctgacgcgggcg
ctggcgctggccctggtgctggccctgctggtcgggccgttcctgagcggcctggcgggg
gcgatcccagcgccggggggccgctgggcgcgcgatgggcaggtccctccagcctcccgc
agccgctcggtgctcctggacgtctcggcgggccagctgcttatggtggacggacgccac
cctgacgccgtggcctgggccaacctcaccaacgccatccgcgagactgggtgggccttc
ctggagctgggcacaagtggccaatacaatgacagcttgcaggcctatgcagccggtgtg
gtggaggctgctgtgtcggaggagctcatctacatgcactggatgaacacggtggtgaat
tactgcggccccttcgagtatgaagtcggctactgcgagaggctgaagagcttcctggag
gccaacctagagtggatgcaggaagagatggagtcaaacccagactcaccttactggcac
caggtgcggctgaccctcctgcagctgaaaggcctggaggacagctacgaaggccgtgtg
agcttcccagctgggaagttcaccatcaaacccttggggttcctcctgctgcagctctct
ggggacctggaagacctggagctggccctgaacaagaccaagatcaaaccttctctgggc
tctggctcctgttctgccctcatcaagctgctccctggccagagtgacctcctggttgcc
cacaacacctggaacaactaccagcacatgctgcgtgtcatcaagaagtactggctccag
ttccgggaaggcccctggggggactacccgctggttcccggcaacaagctggtcttctcc
tcctaccccggcaccatcttctcctgcgacgacttctacatcctgggcagtgggctggtg
acactggagaccaccattggcaacaagaacccagccctgtggaagtatgtgcggcccagg
ggctgtgtgctggagtgggtacgcaacatcgtggccaaccgcctggcctcggatggggcc
acctgggcagacatcttcaagaggttcaacagcggcacgtataacaaccagtggatgatc
gtggactacaaggcgttcatcccgggtgggcccagccccgggagccgggtgcttaccatc
ctggagcagatccccggcatggtggtggtggctgacaagacctcggagctctaccagaag
acctactgggccagctacaacataccgtccttcgagactgtgttcaatgccagtgggctg
caggccctagtggcccagtatggggactggttttcttatgacgggagcccccgggcccag
atcttccggcggaaccagtcactggtacaagacatggactccatggtcaggctgatgagg
tacaatgacttcctccatgaccctctgtcactgtgcaaagcctgcaacccccagcccaat
ggggagaatgctatctccgcccgctccgacctcaacccggccaatggctcctaccccttc
caggccctgcgtcagcgctcccatgggggtatcgatgtgaaggtgaccagcatgtcactg
gccaggatcctgagcctgctggcggccagcggtcccacgtgggaccaggtgcccccgttc
cagtggagcacctcgcccttcagcggcctgctgcacatgggccagccagacctctggaag
ttcgcgcctgtcaaggtttcatgggactga

DBGET integrated database retrieval system