KEGG   Homo sapiens (human): 1965Help
Entry
1965              CDS       T01001                                 

Gene name
EIF2S1, EIF-2, EIF-2A, EIF-2alpha, EIF2, EIF2A
Definition
(RefSeq) eukaryotic translation initiation factor 2 subunit alpha
  KO
K03237  translation initiation factor 2 subunit 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  RNA transport
hsa04140  Autophagy - animal
hsa04141  Protein processing in endoplasmic reticulum
hsa04210  Apoptosis
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05160  Hepatitis C
hsa05162  Measles
hsa05164  Influenza A
hsa05168  Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    1965 (EIF2S1)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    1965 (EIF2S1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    1965 (EIF2S1)
  09143 Cell growth and death
   04210 Apoptosis
    1965 (EIF2S1)
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    1965 (EIF2S1)
  09172 Infectious diseases: Viral
   05162 Measles
    1965 (EIF2S1)
   05164 Influenza A
    1965 (EIF2S1)
   05160 Hepatitis C
    1965 (EIF2S1)
   05168 Herpes simplex infection
    1965 (EIF2S1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:hsa03012]
    1965 (EIF2S1)
Translation factors [BR:hsa03012]
 Eukaryotic Type
  Initiation factors
   eIF-2
    1965 (EIF2S1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EIF_2_alpha S1 DUF4453
Motif
Other DBs
NCBI-GeneID: 1965
NCBI-ProteinID: NP_004085
OMIM: 603907
HGNC: 3265
Ensembl: ENSG00000134001
Vega: OTTHUMG00000029800
Pharos: P05198(Tbio)
UniProt: P05198 Q53XC0
Structure
PDB: 

Position
14q23.3
AA seq 315 aa AA seqDB search
MPGLSCRFYQHKFPEVEDVVMVNVRSIAEMGAYVSLLEYNNIEGMILLSELSRRRIRSIN
KLIRIGRNECVVVIRVDKEKGYIDLSKRRVSPEEAIKCEDKFTKSKTVYSILRHVAEVLE
YTKDEQLESLFQRTAWVFDDKYKRPGYGAYDAFKHAVSDPSILDSLDLNEDEREVLINNI
NRRLTPQAVKIRADIEVACYGYEGIDAVKEALRAGLNCSTENMPIKINLIAPPRYVMTTT
TLERTEGLSVLSQAMAVIKEKIEEKRGVFNVQMEPKVVTDTDETELARQMERLERENAEV
DGDDDAEEMEAKAED
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgccgggtctaagttgtagattttatcaacacaaatttcctgaggtggaagatgtagtg
atggtgaatgtcagatccattgctgaaatgggggcttatgtcagcttgctggaatacaac
aacattgaaggcatgattcttcttagtgaattatccagaaggcgtatccgttctatcaac
aaactcatccgaattggcaggaatgagtgtgtggttgtcattagggtggacaaagaaaaa
ggatatattgatttgtcaaaaagaagagtttctccagaggaagcaatcaaatgtgaagac
aaattcacaaaatccaaaactgtttatagcattcttcgtcatgttgctgaggtgttagaa
tacaccaaggatgagcagctggaaagcctattccagaggactgcctgggtctttgatgac
aagtacaagagacctggatatggtgcctatgatgcatttaagcatgcagtctcagaccca
tctattttggatagtttagatttgaatgaagatgaacgggaagtactcattaataatatt
aataggcgcttgaccccacaggctgtcaaaattcgagcagatattgaagtggcttgttat
ggttatgaaggcattgatgctgtaaaagaagccctaagagcaggtttgaattgttctaca
gaaaacatgcccattaagattaatctaatagctcctcctcggtatgtaatgactacgaca
accctggagagaacagaaggcctttctgtcctcagtcaagctatggctgttatcaaagag
aagattgaggaaaagaggggtgtgttcaatgttcaaatggagcccaaagtggtcacagat
acagatgagactgaacttgcgaggcagatggagaggcttgaaagagaaaatgccgaagtg
gatggagatgatgatgcagaagaaatggaagccaaagctgaagattaa

DBGET integrated database retrieval system