KEGG   Homo sapiens (human): 196528Help
Entry
196528            CDS       T01001                                 

Gene name
ARID2, BAF200, CSS6, p200
Definition
(RefSeq) AT-rich interaction domain 2
  KO
K11765  AT-rich interactive domain-containing protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa05225  Hepatocellular carcinoma
Disease
H00048  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09162 Cancers: Specific types
   05225 Hepatocellular carcinoma
    196528 (ARID2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    196528 (ARID2)
   03036 Chromosome and associated proteins [BR:hsa03036]
    196528 (ARID2)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     196528 (ARID2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Chromatin remodeling factors
   PBAF complex
    196528 (ARID2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ARID RFX_DNA_binding
Motif
Other DBs
NCBI-GeneID: 196528
NCBI-ProteinID: NP_689854
OMIM: 609539
HGNC: 18037
Ensembl: ENSG00000189079
Vega: OTTHUMG00000150487
Pharos: Q68CP9(Tbio)
UniProt: Q68CP9
Position
12q12
AA seq 1835 aa AA seqDB search
MANSTGKAPPDERRKGLAFLDELRQFHHSRGSPFKKIPAVGGKELDLHGLYTRVTTLGGF
AKVSEKNQWGEIVEEFNFPRSCSNAAFALKQYYLRYLEKYEKVHHFGEDDDEVPPGNPKP
QLPIGAIPSSYNYQQHSVSDYLRQSYGLSMDFNSPNDYNKLVLSLLSGLPNEVDFAINVC
TLLSNESKHVMQLEKDPKIITLLLANAGVFDDTLGSFSTVFGEEWKEKTDRDFVKFWKDI
VDDNEVRDLISDRNKSHEGTSGEWIWESLFHPPRKLGINDIEGQRVLQIAVILRNLSFEE
GNVKLLAANRTCLRFLLLSAHSHFISLRQLGLDTLGNIAAELLLDPVDFKTTHLMFHTVT
KCLMSRDRFLKMRGMEILGNLCKAEDNGVLICEYVDQDSYREIICHLTLPDVLLVISTLE
VLYMLTEMGDVACTKIAKVEKSIDMLVCLVSMDIQMFGPDALAAVKLIEHPSSSHQMLSE
IRPQAIEQVQTQTHVASAPASRAVVAQHVAPPPGIVEIDSEKFACQWLNAHFEVNPDCSV
SRAEMYSEYLSTCSKLARGGILTSTGFYKCLRTVFPNHTVKRVEDSSSNGQAHIHVVGVK
RRAIPLPIQMYYQQQPVSTSVVRVDSVPDVSPAPSPAGIPHGSQTIGNHFQRTPVANQSS
NLTATQMSFPVQGVHTVAQTVSRIPQNPSPHTHQQQNAPVTVIQSKAPIPCEVVKATVIQ
NSIPQTGVPVSIAVGGGPPQSSVVQNHSTGPQPVTVVNSQTLLHHPSVIPQQSPLHTVVP
GQIPSGTPVTVIQQAVPQSHMFGRVQNIPACTSTVSQGQQLITTSPQPVQTSSQQTSAGS
QSQDTVIIAPPQYVTTSASNIVSATSVQNFQVATGQMVTIAGVPSPQASRVGFQNIAPKP
LPSQQVSSTVVQQPIQQPQQPTQQSVVIVSQPAQQGQTYAPAIHQIVLANPAALPAGQTV
QLTGQPNITPSSSPSPVPATNNQVPTAMSSSSTPQSQGPPPTVSQMLSVKRQQQQQHSPA
PPPQQVQVQVQQPQQVQMQVQPQQSNAGVGQPASGESSLIKQLLLPKRGPSTPGGKLILP
APQIPPPNNARAPSPQVVYQVASNQAAGFGVQGQTPAQQLLVGQQNVQLVPSAMPPSGGV
QTVPISNLQILPGPLISNSPATIFQGTSGNQVTITVVPNTSFAPATVSQGNATQLIAPAG
ITMSGTQTGVGLPVQTLPATQASPAGQSSCTTATPPFKGDKIICQKEEEAKEATGLHVHE
RKIEVMENPSCRRGATNTSNGDTKENEMHVGSLLNGRKYSDSSLPPSNSGKIQSETNQCS
LISNGPSLELGENGASGKQNSEQIDMQDIKSDLRKPLVNGICDFDKGDGSHLSKNIPNHK
TSNHVGNGEISPMEPQGTLDITQQDTAKGDQLERISNGPVLTLGGSSVSSIQEASNAATQ
QFSGTDLLNGPLASSLNSDVPQQRPSVVVSPHSTTSVIQGHQIIAVPDSGSKVSHSPALS
SDVRSTNGTAECKTVKRPAEDTDRETVAGIPNKVGVRIVTISDPNNAGCSATMVAVPAGA
DPSTVAKVAIESAVQQKQQHPPTYVQNVVPQNTPMPPSPAVQVQGQPNSSQPSPFSGSSQ
PGDPMRKPGQNFMCLWQSCKKWFQTPSQVFYHAATEHGGKDVYPGQCLWEGCEPFQRQRF
SFITHLQDKHCSKDALLAGLKQDEPGQAGSQKSSTKQPTVGGTSSTPRAQKAIVNHPSAA
LMALRRGSRNLVFRDFTDEKEGPITKHIRLTAALILKNIGKYSECGRRLLKRHENNLSVL
AISNMEASSTLAKCLYELNFTVQSKEQEKDSEMLQ
NT seq 5508 nt NT seq  +upstreamnt  +downstreamnt
atggcaaactcgacggggaaggcgcctccggacgagcggagaaagggactcgctttcctg
gacgagctgcggcagttccaccacagcagagggtcgccttttaaaaaaatccctgcggtg
ggtgggaaggagctggatcttcacggtctctacaccagagtcactactttaggcggattc
gcgaaggtttctgagaagaatcagtggggagaaattgttgaagagttcaactttcccaga
agttgttctaacgctgcctttgctttaaaacagtattacttgcgttacctagaaaagtac
gagaaagttcatcattttggggaggatgatgatgaggtaccaccaggcaatccaaagcca
cagcttcctattggtgcaattccatcttcctacaattaccagcaacacagtgtgtcggat
tatctgcgtcaaagttatgggctgtccatggactttaattcgccaaatgattataataaa
ttggtgctttcactgttatctggactcccaaatgaagtggactttgctattaacgtatgc
actctcctatcaaatgaaagcaagcacgtcatgcaacttgaaaaagatcctaaaatcatc
actttactacttgctaatgccggggtgtttgacgacactttaggatccttttccactgta
tttggagaagaatggaaagagaagactgatagagacttcgttaagttttggaaagacatc
gttgatgataatgaagttcgtgacctcatttctgacagaaacaagtctcatgaaggtaca
tcaggagaatggatttgggagtctttatttcatccacctcgaaagctgggcattaacgat
attgaaggacagcgggtacttcagattgcagtgattttgagaaatctttcctttgaggag
ggcaatgttaagctcttggcagctaatcgtacctgtcttcgtttcctattactttctgca
catagtcattttatttctttaaggcaattaggccttgacacattaggaaatattgcagct
gagcttttactggaccctgttgatttcaaaactactcatctgatgtttcatactgttaca
aaatgtctaatgtcaagggatagatttttaaagatgagaggcatggaaattttgggaaat
ctttgcaaagcagaagataatggtgttttaatttgtgaatatgtggatcaggattcctac
agagagatcatttgtcatctcactttacctgatgtgctgcttgtaatctcaacactcgag
gtgctatacatgctcacggaaatgggagatgttgcttgcacaaaaattgcaaaagtagaa
aagagcatagacatgttagtgtgtctggtttctatggatattcagatgtttggccctgat
gcactagctgcggtaaaactcattgaacacccaagttccagtcatcaaatgttatctgaa
attaggccacaagctatagagcaagtccaaacccagactcatgtagcatctgccccagct
tccagagcagttgtagcgcagcatgttgctccacctccaggaatagtggaaatagatagt
gagaagtttgcttgtcagtggctaaatgctcattttgaagtaaatccagattgttctgtt
tctcgagcagaaatgtattctgaatacctctcgacttgcagtaaattagctcgtggtgga
atcctaacatcaactggattttataaatgtcttagaacggtctttccaaatcatacagtg
aagagagtggaggattccagtagcaatgggcaggcacatattcatgtggtaggagtaaaa
cggagggctataccacttcccattcagatgtactatcagcagcaaccagtttctacttct
gttgttcgtgttgattctgttcctgatgtatctcctgctccttcacctgcaggaatccct
catggatcacaaaccataggaaaccattttcagaggactcctgttgccaaccaatcttca
aatctgactgcaacacaaatgtcttttcctgtacaaggtgttcatactgtggcacaaact
gtttcaagaattccacaaaatccttcacctcatacccaccagcaacaaaatgctccagtg
actgtcattcaaagtaaagctccaattccttgtgaagttgttaaggctacagttatccag
aattccataccccagacaggagttcctgttagtattgctgttggaggaggacctccacag
agttctgttgttcagaatcatagtacagggccacaacctgttacagttgtgaattctcag
acattgcttcaccatccatctgtaattccacagcagtctccattacacacagtggtacca
ggacagatcccttcaggcactcctgttacagtaattcaacaagctgtcccacagagtcat
atgtttggcagagtacagaacataccagcatgtacttctacagtttcacagggtcaacag
ttaatcaccacatcaccccaacctgtgcaaacttcatctcaacagacatcagctggtagc
cagtcacaagatactgttatcatagcacccccacagtatgtaacaacttctgcatccaat
attgtctcagcaacttcagtacagaattttcaggtagctacaggacaaatggttactatt
gctggtgtcccaagtccacaagcctcaagggtagggtttcagaacattgcaccaaaacct
ctcccttctcagcaagtttcatctacagtggtacagcagcctattcaacaaccacagcag
ccaacccaacaaagcgtagtgattgtaagccagccagctcaacaaggtcaaacttatgca
ccagccattcaccaaattgttcttgctaatccagcagctcttccagctggtcagacagtt
cagctaactggacaacctaacataactccatcttcttcaccatcacctgtcccagctact
aataaccaagtccctactgccatgtcgtcgtcctctacccctcaatcacagggaccacct
cctactgtcagtcaaatgttatctgtgaaaaggcagcaacagcagcaacattcaccagca
cccccaccacagcaggtacaagtacaagttcagcagccccaacaagtacagatgcaagtt
caacctcaacagtcgaatgcaggagttggtcagcctgcctctggtgagtcgagtctgatt
aaacagcttctgcttccgaaacgtggtccttcaacaccaggtggtaagcttattctccca
gctccacagattcctccccctaataatgcaagagctcctagccctcaggtggtctatcag
gtggccagtaaccaagccgcaggttttggagtgcaggggcaaactccagctcagcagcta
ttggttgggcagcaaaatgttcagttggtcccaagtgcaatgccaccctcagggggagta
caaactgtgcccatttcgaacttacaaatattgccaggtccactgatctcaaatagccca
gcaaccattttccaagggacttctggcaaccaggtaaccataacagttgtgccaaatacg
agttttgcacctgcaactgtgagtcagggaaatgcaactcagctcattgctccagcagga
attaccatgagcggaacgcagacaggagttggacttccagtacaaacgcttccagccact
caagcatctcctgctggacaatcatcatgtactactgctactcccccattcaaaggtgat
aaaataatttgccaaaaggaggaggaagcaaaggaagcaacaggtttacatgttcatgaa
cgtaaaattgaagtcatggagaacccgtcctgccgacgaggagccacaaacaccagcaat
ggggatacaaaggaaaatgaaatgcatgtgggaagtcttttaaatgggagaaagtacagt
gactcaagtctacctccttcaaactcagggaaaattcaaagtgagactaatcagtgctca
ctaatcagtaatgggccatcattggaattaggtgagaatggagcatctgggaaacagaac
tcagaacaaatagacatgcaagatatcaaaagtgatttgagaaaaccgctagttaatgga
atctgtgattttgataaaggagatggttctcatttaagcaaaaacattccaaatcataaa
acttccaatcatgtaggaaatggtgagatatctccaatggaaccacaagggactttagat
atcactcagcaagatactgccaaaggtgatcaactagaaagaatttctaatggacctgta
ttaactttgggtggttcatctgtgagcagtatacaggaggcttcaaatgcggcaacacag
caatttagtggtactgatttgcttaatggacctctagcttcaagtttgaattcagatgtg
cctcagcaacgcccaagtgtagttgtctcaccacattctacaacctctgttatacaggga
catcaaatcatagcagttcccgactcaggatcaaaagtatcccattctcctgccctatca
tctgacgttcggtctacaaatggcacagcagaatgcaaaactgtaaagaggccagcagag
gatactgatagggaaacagtcgcaggaattccaaataaagtaggagttagaattgttaca
atcagtgaccccaacaatgctggctgcagcgcaacaatggttgctgtgccagcaggagca
gatccaagcactgtagctaaagtagcaatagaaagtgctgttcagcaaaagcaacagcat
ccaccaacatatgtacagaatgtggtcccgcagaacactcctatgccaccttcaccagct
gtacaagtgcagggccagcctaacagttctcagccttctccattcagtggatccagtcag
cctggagatccaatgagaaaacctggacagaacttcatgtgtctgtggcagtcttgtaaa
aagtggtttcagacaccctcacaggttttctaccatgcagcaactgaacatggaggaaaa
gatgtatatccagggcagtgtctttgggaaggttgtgagccttttcagcgacagcggttt
tcttttattacccacttgcaggataagcactgttcaaaggatgccctacttgcaggatta
aaacaagatgaaccaggacaagcaggaagtcagaagtcttctaccaagcagccaactgta
gggggcacaagctcaactcctagagcacaaaaggccattgtgaatcatcccagtgctgca
cttatggctctgaggagaggatcaagaaaccttgtctttcgagattttacagatgaaaaa
gagggaccaataactaaacacatccgactaacagctgccttaatattaaaaaatattggt
aaatattcagaatgtggtcgcagattgttaaagagacatgaaaataacttatcagtgcta
gccattagtaacatggaagcttcctccacccttgccaaatgcctttatgaacttaatttt
acagttcagagtaaggaacaagaaaaagactcagaaatgctgcagtga

DBGET integrated database retrieval system