KEGG   Homo sapiens (human): 196792
Entry
196792            CDS       T01001                                 

Gene name
FAM24B
Definition
(RefSeq) family with sequence similarity 24 member B
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: FAM24 Ly49 FAM163
Other DBs
NCBI-GeneID: 196792
NCBI-ProteinID: NP_001191293
HGNC: 23475
Ensembl: ENSG00000213185
Vega: OTTHUMG00000019194
Pharos: Q8N5W8(Tdark)
UniProt: Q8N5W8
Position
10q26.13
AA seq 94 aa
MPVIAGGILAALLLLIVVVLCLYFKIHNALKAAKEPEAVAVKNHNPDKVWWAKNSQAKTI
ATESCPALQCCEGYRMCASFDSLPPCCCDINEGL
NT seq 285 nt   +upstreamnt  +downstreamnt
atgcctgtcatcgctggtggtatcctggcggccttgctcctgctgatagttgtcgtgctc
tgtctttacttcaaaatacacaacgcgctaaaagctgcaaaggaacctgaagctgtggct
gtaaaaaatcacaacccagacaaggtgtggtgggccaagaacagccaggccaaaaccatt
gccacggagtcttgtcctgccctgcagtgctgtgaaggatatagaatgtgtgccagtttt
gattccctgccaccttgctgttgcgacataaatgagggcctctga

DBGET integrated database retrieval system