KEGG   Homo sapiens (human): 1969Help
Entry
1969              CDS       T01001                                 

Gene name
EPHA2, ARCC2, CTPA, CTPP1, CTRCT6, ECK
Definition
(RefSeq) EPH receptor A2
  KO
K05103  Eph receptor A2 [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04360  Axon guidance
Disease
H01202  Cataract
Drug target
Dasatinib (DG00714): D03658 D06414
Sitravatinib: D11140
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    1969 (EPHA2)
   04015 Rap1 signaling pathway
    1969 (EPHA2)
   04010 MAPK signaling pathway
    1969 (EPHA2)
   04151 PI3K-Akt signaling pathway
    1969 (EPHA2)
 09150 Organismal Systems
  09158 Development
   04360 Axon guidance
    1969 (EPHA2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    1969 (EPHA2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     1969 (EPHA2)
Protein kinases [BR:hsa01001]
 Receptor tyrosine kinases (RTK)
  EPH family [OT]
   1969 (EPHA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Ephrin_lbd Pkinase fn3 SAM_1 EphA2_TM SAM_2 Pur_ac_phosph_N Interfer-bind DUF2369 Ephrin_rec_like Haspin_kinase SKG6
Motif
Other DBs
NCBI-GeneID: 1969
NCBI-ProteinID: NP_004422
OMIM: 176946
HGNC: 3386
Ensembl: ENSG00000142627
Vega: OTTHUMG00000009527
Pharos: P29317(Tclin)
UniProt: P29317 A0A024QZA8
Structure
PDB: 

Position
1p36.13
AA seq 976 aa AA seqDB search
MELQAARACFALLWGCALAAAAAAQGKEVVLLDFAAAGGELGWLTHPYGKGWDLMQNIMN
DMPIYMYSVCNVMSGDQDNWLRTNWVYRGEAERIFIELKFTVRDCNSFPGGASSCKETFN
LYYAESDLDYGTNFQKRLFTKIDTIAPDEITVSSDFEARHVKLNVEERSVGPLTRKGFYL
AFQDIGACVALLSVRVYYKKCPELLQGLAHFPETIAGSDAPSLATVAGTCVDHAVVPPGG
EEPRMHCAVDGEWLVPIGQCLCQAGYEKVEDACQACSPGFFKFEASESPCLECPEHTLPS
PEGATSCECEEGFFRAPQDPASMPCTRPPSAPHYLTAVGMGAKVELRWTPPQDSGGREDI
VYSVTCEQCWPESGECGPCEASVRYSEPPHGLTRTSVTVSDLEPHMNYTFTVEARNGVSG
LVTSRSFRTASVSINQTEPPKVRLEGRSTTSLSVSWSIPPPQQSRVWKYEVTYRKKGDSN
SYNVRRTEGFSVTLDDLAPDTTYLVQVQALTQEGQGAGSKVHEFQTLSPEGSGNLAVIGG
VAVGVVLLLVLAGVGFFIHRRRKNQRARQSPEDVYFSKSEQLKPLKTYVDPHTYEDPNQA
VLKFTTEIHPSCVTRQKVIGAGEFGEVYKGMLKTSSGKKEVPVAIKTLKAGYTEKQRVDF
LGEAGIMGQFSHHNIIRLEGVISKYKPMMIITEYMENGALDKFLREKDGEFSVLQLVGML
RGIAAGMKYLANMNYVHRDLAARNILVNSNLVCKVSDFGLSRVLEDDPEATYTTSGGKIP
IRWTAPEAISYRKFTSASDVWSFGIVMWEVMTYGERPYWELSNHEVMKAINDGFRLPTPM
DCPSAIYQLMMQCWQQERARRPKFADIVSILDKLIRAPDSLKTLADFDPRVSIRLPSTSG
SEGVPFRTVSEWLESIKMQQYTEHFMAAGYTAIEKVVQMTNDDIKRIGVRLPGHQKRIAY
SLLGLKDQVNTVGIPI
NT seq 2931 nt NT seq  +upstreamnt  +downstreamnt
atggagctccaggcagcccgcgcctgcttcgccctgctgtggggctgtgcgctggccgcg
gccgcggcggcgcagggcaaggaagtggtactgctggactttgctgcagctggaggggag
ctcggctggctcacacacccgtatggcaaagggtgggacctgatgcagaacatcatgaat
gacatgccgatctacatgtactccgtgtgcaacgtgatgtctggcgaccaggacaactgg
ctccgcaccaactgggtgtaccgaggagaggctgagcgtatcttcattgagctcaagttt
actgtacgtgactgcaacagcttccctggtggcgccagctcctgcaaggagactttcaac
ctctactatgccgagtcggacctggactacggcaccaacttccagaagcgcctgttcacc
aagattgacaccattgcgcccgatgagatcaccgtcagcagcgacttcgaggcacgccac
gtgaagctgaacgtggaggagcgctccgtggggccgctcacccgcaaaggcttctacctg
gccttccaggatatcggtgcctgtgtggcgctgctctccgtccgtgtctactacaagaag
tgccccgagctgctgcagggcctggcccacttccctgagaccatcgccggctctgatgca
ccttccctggccactgtggccggcacctgtgtggaccatgccgtggtgccaccggggggt
gaagagccccgtatgcactgtgcagtggatggcgagtggctggtgcccattgggcagtgc
ctgtgccaggcaggctacgagaaggtggaggatgcctgccaggcctgctcgcctggattt
tttaagtttgaggcatctgagagcccctgcttggagtgccctgagcacacgctgccatcc
cctgagggtgccacctcctgcgagtgtgaggaaggcttcttccgggcacctcaggaccca
gcgtcgatgccttgcacacgacccccctccgccccacactacctcacagccgtgggcatg
ggtgccaaggtggagctgcgctggacgccccctcaggacagcgggggccgcgaggacatt
gtctacagcgtcacctgcgaacagtgctggcccgagtctggggaatgcgggccgtgtgag
gccagtgtgcgctactcggagcctcctcacggactgacccgcaccagtgtgacagtgagc
gacctggagccccacatgaactacaccttcaccgtggaggcccgcaatggcgtctcaggc
ctggtaaccagccgcagcttccgtactgccagtgtcagcatcaaccagacagagcccccc
aaggtgaggctggagggccgcagcaccacctcgcttagcgtctcctggagcatccccccg
ccgcagcagagccgagtgtggaagtacgaggtcacttaccgcaagaagggagactccaac
agctacaatgtgcgccgcaccgagggtttctccgtgaccctggacgacctggccccagac
accacctacctggtccaggtgcaggcactgacgcaggagggccagggggccggcagcaag
gtgcacgaattccagacgctgtccccggagggatctggcaacttggcggtgattggcggc
gtggctgtcggtgtggtcctgcttctggtgctggcaggagttggcttctttatccaccgc
aggaggaagaaccagcgtgcccgccagtccccggaggacgtttacttctccaagtcagaa
caactgaagcccctgaagacatacgtggacccccacacatatgaggaccccaaccaggct
gtgttgaagttcactaccgagatccatccatcctgtgtcactcggcagaaggtgatcgga
gcaggagagtttggggaggtgtacaagggcatgctgaagacatcctcggggaagaaggag
gtgccggtggccatcaagacgctgaaagccggctacacagagaagcagcgagtggacttc
ctcggcgaggccggcatcatgggccagttcagccaccacaacatcatccgcctagagggc
gtcatctccaaatacaagcccatgatgatcatcactgagtacatggagaatggggccctg
gacaagttccttcgggagaaggatggcgagttcagcgtgctgcagctggtgggcatgctg
cggggcatcgcagctggcatgaagtacctggccaacatgaactatgtgcaccgtgacctg
gctgcccgcaacatcctcgtcaacagcaacctggtctgcaaggtgtctgactttggcctg
tcccgcgtgctggaggacgaccccgaggccacctacaccaccagtggcggcaagatcccc
atccgctggaccgccccggaggccatttcctaccggaagttcacctctgccagcgacgtg
tggagctttggcattgtcatgtgggaggtgatgacctatggcgagcggccctactgggag
ttgtccaaccacgaggtgatgaaagccatcaatgatggcttccggctccccacacccatg
gactgcccctccgccatctaccagctcatgatgcagtgctggcagcaggagcgtgcccgc
cgccccaagttcgctgacatcgtcagcatcctggacaagctcattcgtgcccctgactcc
ctcaagaccctggctgactttgacccccgcgtgtctatccggctccccagcacgagcggc
tcggagggggtgcccttccgcacggtgtccgagtggctggagtccatcaagatgcagcag
tatacggagcacttcatggcggccggctacactgccatcgagaaggtggtgcagatgacc
aacgacgacatcaagaggattggggtgcggctgcccggccaccagaagcgcatcgcctac
agcctgctgggactcaaggaccaggtgaacactgtggggatccccatctga

DBGET integrated database retrieval system