KEGG   Homo sapiens (human): 197Help
Entry
197               CDS       T01001                                 

Gene name
AHSG, A2HS, AHS, APMR1, FETUA, HSGA
Definition
(RefSeq) alpha 2-HS glycoprotein
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Cystatin Cathelicidins
Motif
Other DBs
NCBI-GeneID: 197
NCBI-ProteinID: NP_001613
OMIM: 138680
HGNC: 349
Ensembl: ENSG00000145192
Vega: OTTHUMG00000156605
Pharos: P02765(Tbio)
UniProt: P02765
Position
3q27.3
AA seq 367 aa AA seqDB search
MKSLVLLLCLAQLWGCHSAPHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTL
NQIDEVKVWPQQPSGELFEIEIDTLETTCHVLDPTPVARCSVRQLKEHAVEGDCDFQLLK
LDGKFSVVYAKCDSSPDSAEDVRKVCQDCPLLAPLNDTRVVHAAKAALAAFNAQNNGSNF
QLEEISRAQLVPLPPSTYVEFTVSGTDCVAKEATEAAKCNLLAEKQYGFCKATLSEKLGG
AEVAVTCMVFQTQPVSSQPQPEGANEAVPTPVVDPDAPPSPPLGAPGLPPAGSPPDSHVL
LAAPPGHQLHRAHYDLRHTFMGVVSLGSPSGEVSHPRKTRTVVQPSVGAAAGPVVPPCPG
RIRHFKV
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgaagtccctcgtcctgctcctttgtcttgctcagctctggggctgccactcagcccca
catggcccagggctgatttatagacaaccgaactgcgatgatccagaaactgaggaagca
gctctggtggctatagactacatcaatcaaaaccttccttggggatacaaacacaccttg
aaccagattgatgaagtaaaggtgtggcctcagcagccctccggagagctgtttgagatt
gaaatagacaccctggaaaccacctgccatgtgctggaccccacccctgtggcaagatgc
agcgtgaggcagctgaaggagcatgctgtcgaaggagactgtgatttccagctgttgaaa
ctagatggcaagttttccgtggtatacgcaaaatgtgattccagtccagactcagccgag
gacgtgcgcaaggtgtgccaagactgccccctgctggccccgctgaacgacaccagggtg
gtgcacgccgcgaaagctgccctggccgccttcaacgctcagaacaacggctccaatttt
cagctggaggaaatttcccgggctcagcttgtgcccctcccaccttctacctatgtggag
tttacagtgtctggcactgactgtgttgctaaagaggccacagaggcagccaagtgtaac
ctgctggcagaaaagcaatatggcttttgtaaggcaacactcagtgagaagcttggtggg
gcagaggttgcagtgacctgcatggtgttccaaacacagcccgtgagctcacagccccaa
ccagaaggtgccaatgaagcagtccccacacccgtggtggacccagatgcacctccgtcc
cctccacttggcgcacctggactccctccagctggctcacccccagactcccatgtgtta
ctggcagctcctccaggacaccagttgcaccgggcgcactacgacctgcgccacaccttc
atgggtgtggtctcattggggtcaccctcaggagaagtgtcgcacccccggaaaacacgc
acagtggtgcagcctagtgttggtgctgctgctgggccagtggttcctccatgtccgggg
aggatcagacacttcaaggtctag

DBGET integrated database retrieval system