KEGG   Homo sapiens (human): 1973
Entry
1973              CDS       T01001                                 
Symbol
EIF4A1, DDX2A, EIF-4A, EIF4A, eIF-4A-I, eIF4A-I
Name
(RefSeq) eukaryotic translation initiation factor 4A1
  KO
K03257  translation initiation factor 4A
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    1973 (EIF4A1)
   03012 Translation factors [BR:hsa03012]
    1973 (EIF4A1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    1973 (EIF4A1)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     1973 (EIF4A1)
   mRNA cycle factors
    Stress granule specific factors
     1973 (EIF4A1)
Translation factors [BR:hsa03012]
 Eukaryotic type
  Initiation factors
   eIF-4
    1973 (EIF4A1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   1973 (EIF4A1)
  Exosomal proteins of bladder cancer cells
   1973 (EIF4A1)
SSDB
Motif
Pfam: DEAD Helicase_C ResIII AAA_19 AAA_30 Flavi_DEAD Helicase_RecD UvrD-helicase
Other DBs
NCBI-GeneID: 1973
NCBI-ProteinID: NP_001407
OMIM: 602641
HGNC: 3282
Ensembl: ENSG00000161960
Pharos: P60842(Tchem)
UniProt: P60842
Structure
Position
17:7572825..7579006
AA seq 406 aa
MSASQDSRSRDNGPDGMEPEGVIESNWNEIVDSFDDMNLSESLLRGIYAYGFEKPSAIQQ
RAILPCIKGYDVIAQAQSGTGKTATFAISILQQIELDLKATQALVLAPTRELAQQIQKVV
MALGDYMGASCHACIGGTNVRAEVQKLQMEAPHIIVGTPGRVFDMLNRRYLSPKYIKMFV
LDEADEMLSRGFKDQIYDIFQKLNSNTQVVLLSATMPSDVLEVTKKFMRDPIRILVKKEE
LTLEGIRQFYINVEREEWKLDTLCDLYETLTITQAVIFINTRRKVDWLTEKMHARDFTVS
AMHGDMDQKERDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRI
GRGGRFGRKGVAINMVTEEDKRTLRDIETFYNTSIEEMPLNVADLI
NT seq 1221 nt   +upstreamnt  +downstreamnt
atgtctgcgagccaggattcccgatccagagacaatggccccgatgggatggagcccgaa
ggcgtcatcgagagtaactggaatgagattgttgacagctttgatgacatgaacctctcg
gagtcccttctccgtggcatctacgcgtatggttttgagaagccctctgccatccagcag
cgagccattctaccttgtatcaagggttatgatgtgattgctcaagcccaatctgggact
gggaaaacggccacatttgccatatcgattctgcagcagattgaattagatctaaaagcc
acccaggccttggtcctagcacccactcgagaattggctcagcagatacagaaggtggtc
atggcactaggagactacatgggcgcctcctgtcacgcctgtatcgggggcaccaacgtg
cgtgctgaggtgcagaaactgcagatggaagctccccacatcatcgtgggtacccctggc
cgtgtgtttgatatgcttaaccggagatacctgtcccccaaatacatcaagatgtttgta
ctggatgaagctgacgaaatgttaagccgtggattcaaggaccagatctatgacatattc
caaaagctcaacagcaacacccaggtagttttgctgtcagccacaatgccttctgatgtg
cttgaggtgaccaagaagttcatgagggaccccattcggattcttgtcaagaaggaagag
ttgaccctggagggtatccgccagttctacatcaacgtggaacgagaggagtggaagctg
gacacactatgtgacttgtatgaaaccctgaccatcacccaggcagtcatcttcatcaac
acccggaggaaggtggactggctcaccgagaagatgcatgctcgagatttcactgtatcc
gccatgcatggagatatggaccaaaaggaacgagacgtgattatgagggagtttcgttct
ggctctagcagagttttgattaccactgacctgctggccagaggcattgatgtgcagcag
gtttctttagtcatcaactatgaccttcccaccaacagggaaaactatatccacagaatc
ggtcgaggtggacggtttggccgtaaaggtgtggctattaacatggtgacagaagaagac
aagaggactcttcgagacattgagaccttctacaacacctccattgaggaaatgcccctc
aatgttgctgacctcatctga

DBGET integrated database retrieval system