KEGG   Homo sapiens (human): 197322
Entry
197322            CDS       T01001                                 

Gene name
ACSF3
Definition
(RefSeq) acyl-CoA synthetase family member 3
  KO
K18660  malonyl-CoA/methylmalonyl-CoA synthetase [EC:6.2.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00061  Fatty acid biosynthesis
hsa00280  Valine, leucine and isoleucine degradation
hsa01100  Metabolic pathways
hsa01212  Fatty acid metabolism
Module
hsa_M00873  Fatty acid biosynthesis in mitochondria, animals
Disease
H02109  Combined malonic and methylmalonic aciduria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    197322 (ACSF3)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    197322 (ACSF3)
Enzymes [BR:hsa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.-  
     197322 (ACSF3)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 197322
NCBI-ProteinID: NP_001120686
OMIM: 614245
HGNC: 27288
Ensembl: ENSG00000176715
Vega: OTTHUMG00000138044
Pharos: Q4G176(Tbio)
UniProt: Q4G176
Position
16q24.3
AA seq 576 aa
MLPHVVLTFRRLGCALASCRLAPARHRGSGLLHTAPVARSDRSAPVFTRALAFGDRIALV
DQHGRHTYRELYSRSLRLSQEICRLCGCVGGDLREERVSFLCANDASYVVAQWASWMSGG
VAVPLYRKHPAAQLEYVICDSQSSVVLASQEYLELLSPVVRKLGVPLLPLTPAIYTGAVE
EPAEVPVPEQGWRNKGAMIIYTSGTTGRPKGVLSTHQNIRAVVTGLVHKWAWTKDDVILH
VLPLHHVHGVVNALLCPLWVGATCVMMPEFSPQQVWEKFLSSETPRINVFMAVPTIYTKL
MEYYDRHFTQPHAQDFLRAVCEEKIRLMVSGSAALPLPVLEKWKNITGHTLLERYGMTEI
GMALSGPLTTAVRLPGSVGTPLPGVQVRIVSENPQREACSYTIHAEGDERGTKVTPGFEE
KEGELLVRGPSVFREYWNKPEETKSAFTLDGWFKTGDTVVFKDGQYWIRGRTSVDIIKTG
GYKVSALEVEWHLLAHPSITDVAVIGVPDMTWGQRVTAVVTLREGHSLSHRELKEWARNV
LAPYAVPSELVLVEEIPRNQMGKIDKKALIRHFHPS
NT seq 1731 nt   +upstreamnt  +downstreamnt
atgctgccccatgtggtgctcaccttccggcgcctgggctgcgccttggcgtcctgccgg
ctggcgcctgcgagacacagaggaagtggtcttctgcacacagccccagtggcccgctcg
gacaggagcgccccggtgttcacccgtgccctggcctttggggacagaatcgccctggtt
gaccagcacggccgccacacgtacagggagctttattcccgcagccttcgcctgtcccag
gagatctgcaggctctgcgggtgtgtcggcggggacctccgggaggagagggtctccttc
ctatgcgctaacgatgcctcctacgtcgtggcccagtgggcgtcatggatgagtggcggt
gtggcagtccccctctacaggaagcatcccgcggcccagctggagtatgtcatctgcgac
tcccagagctctgtggtccttgccagccaggagtacctggagctcctgagcccggtggtc
aggaagctgggggtcccgctgctgccgctcacaccagccatctacactggagcagtagag
gaaccggcagaggtcccggtcccagagcagggatggaggaacaagggcgccatgatcatc
tacaccagtgggaccacggggaggcccaagggcgtgctgagcacgcaccaaaacatcagg
gctgtggtgaccgggctggtccacaagtgggcatggaccaaagacgacgtgatcctccac
gtgctcccgctgcaccacgtccatggtgtggtcaacgcgctgctctgtcctctctgggtg
ggagccacctgtgtgatgatgcctgagttcagccctcagcaggtttgggaaaagttctta
agttctgaaacgccgcggatcaatgtctttatggcagtgcctacaatatacaccaagctg
atggagtactacgacaggcattttacccagccgcacgcccaggatttcttgcgtgcagtt
tgtgaagaaaaaattaggctgatggtctcaggctcagctgccctgcccctcccagtgctg
gagaagtggaagaacatcacgggccacaccctgctggagcggtatggcatgaccgagatc
ggcatggctctgtccgggcccctgaccactgccgtgcgcctgccaggttccgtggggacc
ccactgcctggagtacaggtgcgcattgtctcagaaaacccacagagggaagcctgctcc
tacaccatccacgcagagggagacgagagggggaccaaggtgaccccagggtttgaagaa
aaggagggggagctgctggtgaggggaccctccgtgtttcgagaatactggaataaacca
gaagaaactaagagtgcattcaccctggatggctggtttaagacaggggacaccgtggtg
tttaaggatggccagtactggatccgaggccggacctcagtggacatcatcaagactgga
ggctacaaggtcagcgccctggaggtggagtggcacctgctggcccaccccagcatcaca
gatgtggctgtgattggagttccggatatgacatggggccagcgggtcactgctgtggtg
accctccgagaaggacactcactgtcccacagggagctcaaagagtgggccagaaatgtc
ctggccccgtacgcggtgccctcggagctggtgctggtggaggagatcccgcggaaccag
atgggcaagattgacaagaaggcgctcatcaggcacttccacccctcatga

DBGET integrated database retrieval system