KEGG   Homo sapiens (human): 197370Help
Entry
197370            CDS       T01001                                 

Gene name
NSMCE1, NSE1
Definition
(RefSeq) NSE1 homolog, SMC5-SMC6 complex component
  KO
K22817  non-structural maintenance of chromosomes element 1 [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    197370 (NSMCE1)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    197370 (NSMCE1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     197370 (NSMCE1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Atypical E3
   197370 (NSMCE1)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    SMC5-SMC6 complex
     197370 (NSMCE1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SMC_Nse1 zf-RING-like C1_1 zf-RING_2 zf-C3HC4 CtsR_C Zn_ribbon_17 His_Me_b4a2
Motif
Other DBs
NCBI-GeneID: 197370
NCBI-ProteinID: NP_659547
OMIM: 617263
HGNC: 29897
Ensembl: ENSG00000169189
Vega: OTTHUMG00000131674
Pharos: Q8WV22(Tdark)
UniProt: Q8WV22
Structure
PDB: 

Position
16p12.1
AA seq 266 aa AA seqDB search
MQGSTRRMGVMTDVHRRFLQLLMTHGVLEEWDVKRLQTHCYKVHDRNATVDKLEDFINNI
NSVLESLYIEIKRGVTEDDGRPIYALVNLATTSISKMATDFAENELDLFRKALELIIDSE
TGFASSTNILNLVDQLKGKKMRKKEAEQVLQKFVQNKWLIEKEGEFTLHGRAILEMEQYI
RETYPDAVKICNICHSLLIQGQSCETCGIRMHLPCVAKYFQSNAEPRCPHCNDYWPHEIP
KVFDPEKERESGVLKSNKKSLRSRQH
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgcagggcagcacaaggagaatgggcgtcatgactgatgtccaccggcgcttcctccag
ttgctgatgacccatggcgtgctagaggaatgggacgtgaagcgcttgcagacgcactgc
tacaaggtccatgaccgcaatgccaccgtagataagttggaggacttcatcaacaacatt
aacagtgtcttggagtccttgtatattgagataaagagaggagtcacggaagatgatggg
agacccatttatgcgttggtgaatcttgctacaacttcaatttccaaaatggctacggat
tttgcagagaatgaactggatttgtttagaaaggctctggaactgattattgactcagaa
accggctttgcgtcttccacaaacatattgaacctggttgatcaacttaaaggcaagaag
atgaggaagaaggaagcggagcaggtgctgcagaagtttgttcaaaacaagtggctgatt
gagaaggaaggggagttcaccctgcacggccgggccatcctggagatggagcaatacatc
cgggagacgtaccccgacgcggtgaagatctgcaatatctgtcacagcctcctcatccag
ggtcaaagctgcgaaacctgtgggatcaggatgcacttaccctgcgtggccaagtacttc
cagtcgaatgctgaaccgcgctgcccccactgcaacgactactggccccacgagatccca
aaagtcttcgaccctgagaaggagagggagtctggtgtcttgaaatcgaacaaaaagtcc
ctgcggtccaggcagcattag

DBGET integrated database retrieval system