KEGG   Homo sapiens (human): 1974Help
Entry
1974              CDS       T01001                                 

Gene name
EIF4A2, BM-010, DDX2B, EIF4A, EIF4F, eIF-4A-II, eIF4A-II
Definition
(RefSeq) eukaryotic translation initiation factor 4A2
  KO
K03257  translation initiation factor 4A
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  RNA transport
Module
hsa_M00428  eIF4F complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    1974 (EIF4A2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:hsa03019]
    1974 (EIF4A2)
   03012 Translation factors [BR:hsa03012]
    1974 (EIF4A2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    1974 (EIF4A2)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     1974 (EIF4A2)
   mRNA cycle factors
    Stress granule specific factors
     1974 (EIF4A2)
Translation factors [BR:hsa03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    1974 (EIF4A2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   1974 (EIF4A2)
  Exosomal proteins of bladder cancer cells
   1974 (EIF4A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DEAD Helicase_C ResIII AAA_19 AAA_30 Helicase_RecD Flavi_DEAD UvrD-helicase tRNA-synt_1b AAA_22
Motif
Other DBs
NCBI-GeneID: 1974
NCBI-ProteinID: NP_001958
OMIM: 601102
HGNC: 3284
Ensembl: ENSG00000156976
Vega: OTTHUMG00000156564
Pharos: Q14240(Tbio)
UniProt: Q14240
Structure
PDB: 

Position
3q27.3
AA seq 407 aa AA seqDB search
MSGGSADYNREHGGPEGMDPDGVIESNWNEIVDNFDDMNLKESLLRGIYAYGFEKPSAIQ
QRAIIPCIKGYDVIAQAQSGTGKTATFAISILQQLEIEFKETQALVLAPTRELAQQIQKV
ILALGDYMGATCHACIGGTNVRNEMQKLQAEAPHIVVGTPGRVFDMLNRRYLSPKWIKMF
VLDEADEMLSRGFKDQIYEIFQKLNTSIQVVLLSATMPTDVLEVTKKFMRDPIRILVKKE
ELTLEGIKQFYINVEREEWKLDTLCDLYETLTITQAVIFLNTRRKVDWLTEKMHARDFTV
SALHGDMDQKERDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHR
IGRGGRFGRKGVAINFVTEEDKRILRDIETFYNTTVEEMPMNVADLI
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgtctggtggctccgcggattataacagagaacatggcggcccagagggaatggacccc
gatggtgtcatcgagagcaactggaatgagattgttgataactttgatgatatgaattta
aaggagtctctccttcgtggcatctatgcttacggttttgagaagccttccgctattcag
cagagagctattattccctgtattaaagggtatgatgtgattgctcaagctcagtcaggt
actggcaagacagccacatttgctatttccatcctgcaacagttggagattgagttcaag
gagacccaagcactagtattggcccccaccagagaactggctcaacagatccaaaaggta
attctggcacttggagactatatgggagccacttgtcatgcctgcattggtggaacaaat
gttcgaaatgaaatgcaaaaactgcaggctgaagcaccacatattgttgttggtacaccc
gggagagtgtttgatatgttaaacagaagatacctttctccaaaatggatcaaaatgttt
gttttggatgaagcagatgaaatgttgagccgtggttttaaggatcaaatctatgagatt
ttccaaaaactaaacacaagtattcaggttgtgttgctttctgccacaatgccaactgat
gtgttggaagtgaccaaaaaattcatgagagatccaattcgaattctggtgaaaaaggaa
gaattgacccttgaaggaatcaaacagttttatattaatgttgagagagaggaatggaag
ttggatacactttgtgacttgtacgagacactgaccattacacaggctgttatttttctc
aatacgaggcgcaaggtggactggctgactgagaagatgcatgccagagacttcacagtt
tctgctctgcatggtgacatggaccagaaggagagagatgttatcatgagggaattccgg
tcagggtcaagtcgtgttctgatcactactgacttgttggctcgcgggattgatgtgcaa
caagtgtctttggttataaattatgatctacctaccaatcgtgaaaactatattcacaga
attggcagagggggtcgatttgggaggaaaggtgtggctataaactttgttactgaagaa
gacaagaggattcttcgtgacattgagactttctacaatactacagtggaggagatgccc
atgaatgtggctgaccttatttaa

DBGET integrated database retrieval system