KEGG   Homo sapiens (human): 1978Help
Entry
1978              CDS       T01001                                 

Gene name
EIF4EBP1, 4E-BP1, 4EBP1, BP-1, PHAS-I
Definition
(RefSeq) eukaryotic translation initiation factor 4E binding protein 1
  KO
K07205  eukaryotic translation initiation factor 4E binding protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa03013  RNA transport
hsa04012  ErbB signaling pathway
hsa04066  HIF-1 signaling pathway
hsa04150  mTOR signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04152  AMPK signaling pathway
hsa04211  Longevity regulating pathway
hsa04218  Cellular senescence
hsa04910  Insulin signaling pathway
hsa05163  Human cytomegalovirus infection
hsa05165  Human papillomavirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05221  Acute myeloid leukemia
hsa05231  Choline metabolism in cancer
Network
nt06114  PI3K signaling (viruses)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
  Element
N00582  IGF-IGF1R-PI3K signaling pathway
N00583  HSV VP11/12 to PI3K signaling pathway
N00584  HSV US3 to MTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    1978 (EIF4EBP1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    1978 (EIF4EBP1)
   04066 HIF-1 signaling pathway
    1978 (EIF4EBP1)
   04151 PI3K-Akt signaling pathway
    1978 (EIF4EBP1)
   04152 AMPK signaling pathway
    1978 (EIF4EBP1)
   04150 mTOR signaling pathway
    1978 (EIF4EBP1)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    1978 (EIF4EBP1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    1978 (EIF4EBP1)
  09149 Aging
   04211 Longevity regulating pathway
    1978 (EIF4EBP1)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    1978 (EIF4EBP1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    1978 (EIF4EBP1)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    1978 (EIF4EBP1)
   05163 Human cytomegalovirus infection
    1978 (EIF4EBP1)
   05165 Human papillomavirus infection
    1978 (EIF4EBP1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    1978 (EIF4EBP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    1978 (EIF4EBP1)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     1978 (EIF4EBP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eIF_4EBP
Motif
Other DBs
NCBI-GeneID: 1978
NCBI-ProteinID: NP_004086
OMIM: 602223
HGNC: 3288
Ensembl: ENSG00000187840
Vega: OTTHUMG00000164012
Pharos: Q13541(Tbio)
UniProt: Q13541
Structure
PDB: 

Position
8p11.23
AA seq 118 aa AA seqDB search
MSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLM
ECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgtccgggggcagcagctgcagccagaccccaagccgggccatccccgccactcgccgg
gtggtgctcggcgacggcgtgcagctcccgcccggggactacagcacgacccccggcggc
acgctcttcagcaccaccccgggaggtaccaggatcatctatgaccggaaattcctgatg
gagtgtcggaactcacctgtgaccaaaacacccccaagggatctgcccaccattccgggg
gtcaccagcccttccagtgatgagccccccatggaagccagccagagccacctgcgcaat
agcccagaagataagcgggcgggcggtgaagagtcacagtttgagatggacatttaa

DBGET integrated database retrieval system