KEGG   Homo sapiens (human): 1984
Entry
1984              CDS       T01001                                 

Gene name
EIF5A, EIF-5A, EIF5A1, eIF-4D, eIF5AI
Definition
(RefSeq) eukaryotic translation initiation factor 5A
  KO
K03263  translation initiation factor 5A
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:hsa03012]
    1984 (EIF5A)
Translation factors [BR:hsa03012]
 Eukaryotic type
  Initiation factors
   eIF-5
    1984 (EIF5A)
SSDB
Motif
Pfam: eIF-5a EFP_N
Other DBs
NCBI-GeneID: 1984
NCBI-ProteinID: NP_001137233
OMIM: 600187
HGNC: 3300
Ensembl: ENSG00000132507
Vega: OTTHUMG00000102197
Pharos: P63241(Tbio)
UniProt: P63241
Structure
PDB: 
3CPF 5DLQ

Position
17p13.1
AA seq 154 aa
MADDLDFETGDAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVG
IDIFTGKKYEDICPSTHNMDVPNIKRNDFQLIGIQDGYLSLLQDSGEVREDLRLPEGDLG
KEIEQKYDCGEEILITVLSAMTEEAAVAIKAMAK
NT seq 465 nt   +upstreamnt  +downstreamnt
atggcagatgacttggacttcgagacaggagatgcaggggcctcagccaccttcccaatg
cagtgctcagcattacgtaagaatggctttgtggtgctcaaaggccggccatgtaagatc
gtcgagatgtctacttcgaagactggcaagcacggccacgccaaggtccatctggttggt
attgacatctttactgggaagaaatatgaagatatctgcccgtcaactcataatatggat
gtccccaacatcaaaaggaatgacttccagctgattggcatccaggatgggtacctatca
ctgctccaggacagcggggaggtacgagaggaccttcgtctccctgagggagaccttggc
aaggagattgagcagaagtacgactgtggagaagagatcctgatcacggtgctgtctgcc
atgacagaggaggcagctgttgcaatcaaggccatggcaaaataa

DBGET integrated database retrieval system