KEGG   Homo sapiens (human): 199
Entry
199               CDS       T01001                                 

Symbol
AIF1, AIF-1, IBA1, IRT-1, IRT1
Name
(RefSeq) allograft inflammatory factor 1
  KO
K18617  allograft inflammatory factor 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    199 (AIF1)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     199 (AIF1)
SSDB
Motif
Pfam: EF-hand_7 EF-hand_6 EF-hand_1
Other DBs
NCBI-GeneID: 199
NCBI-ProteinID: NP_001614
OMIM: 601833
HGNC: 352
Ensembl: ENSG00000204472
Vega: OTTHUMG00000031246
Pharos: P55008(Tbio)
UniProt: P55008 Q4V347
Structure
PDB: 
2D58 2G2B

Position
6p21.33
AA seq 147 aa
MSQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLN
GNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKM
ILMYEEKAREKEKPTGPPAKKAISELP
NT seq 444 nt   +upstreamnt  +downstreamnt
atgagccaaaccagggatttacagggaggaaaagctttcggactgctgaaggcccagcag
gaagagaggctggatgagatcaacaagcaattcctagacgatcccaaatatagcagtgat
gaggatctgccctccaaactggaaggcttcaaagagaaatacatggagtttgaccttaat
ggaaatggcgatattgatatcatgtccctgaaacgaatgctggagaaacttggagtcccc
aagactcacctagagctaaagaaattaattggagaggtgtccagtggctccggggagacg
ttcagctaccctgactttctcaggatgatgctgggcaagagatctgccatcctaaaaatg
atcctgatgtatgaggaaaaagcgagagaaaaggaaaagccaacaggccccccagccaag
aaagctatctctgagttgccctga

DBGET integrated database retrieval system