KEGG   Homo sapiens (human): 1992Help
Entry
1992              CDS       T01001                                 

Gene name
SERPINB1, EI, ELANH2, HEL-S-27, HEL57, LEI, M/NEI, MNEI, PI-2, PI2
Definition
(RefSeq) serpin family B member 1
  KO
K23425  leukocyte elastase inhibitor
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    1992 (SERPINB1)
Peptidases and inhibitors [BR:hsa01002]
 Peptidase inhibitors
  Family I4: serpin family
   1992 (SERPINB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Serpin
Motif
Other DBs
NCBI-GeneID: 1992
NCBI-ProteinID: NP_109591
OMIM: 130135
HGNC: 3311
Ensembl: ENSG00000021355
Vega: OTTHUMG00000014124
Pharos: P30740(Tbio)
UniProt: P30740 V9HWH1
Structure
PDB: 

Position
6p25.2
AA seq 379 aa AA seqDB search
MEQLSSANTRFALDLFLALSENNPAGNIFISPFSISSAMAMVFLGTRGNTAAQLSKTFHF
NTVEEVHSRFQSLNADINKRGASYILKLANRLYGEKTYNFLPEFLVSTQKTYGADLASVD
FQHASEDARKTINQWVKGQTEGKIPELLASGMVDNMTKLVLVNAIYFKGNWKDKFMKEAT
TNAPFRLNKKDRKTVKMMYQKKKFAYGYIEDLKCRVLELPYQGEELSMVILLPDDIEDES
TGLKKIEEQLTLEKLHEWTKPENLDFIEVNVSLPRFKLEESYTLNSDLARLGVQDLFNSS
KADLSGMSGARDIFISKIVHKSFVEVNEEGTEAAAATAGIATFCMLMPEENFTADHPFLF
FIRHNSSGSILFLGRFSSP
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atggagcagctgagctcagcaaacacccgcttcgccttggacctgttcctggcgttgagt
gagaacaatccggctggaaacatcttcatctctcccttcagcatttcatctgctatggcc
atggtttttctggggaccagaggtaacacggcagcacagctgtccaagactttccatttc
aacacggttgaagaggttcattcaagattccagagtctgaatgctgatatcaacaaacgt
ggagcgtcttatattctgaaacttgctaatagattatatggagagaaaacttacaatttc
cttcctgagttcttggtttcgactcagaaaacatatggtgctgacctggccagtgtggat
tttcagcatgcctctgaagatgcaaggaagaccataaaccagtgggtcaaaggacagaca
gaaggaaaaattccggaactgttggcttcgggcatggttgataacatgaccaaacttgtg
ctagtaaatgccatctatttcaagggaaactggaaggataaattcatgaaagaagccacg
acgaatgcaccattcagattgaataagaaagacagaaaaactgtgaaaatgatgtatcag
aagaaaaaatttgcatatggctacatcgaggaccttaagtgccgtgtgctggaactgcct
taccaaggcgaggagctcagcatggtcatcctgctgccggatgacattgaggacgagtcc
acgggcctgaagaagattgaggaacagttgactttggaaaagttgcatgagtggactaaa
cctgagaatctcgatttcattgaagttaatgtcagcttgcccaggttcaaactggaagag
agttacactctcaactccgacctcgcccgcctaggtgtgcaggatctctttaacagtagc
aaggctgatctgtctggcatgtcaggagccagagatatttttatatcaaaaattgtccac
aagtcatttgtggaagtgaatgaagagggaacagaggcggcagctgccacagcaggcatc
gcaactttctgcatgttgatgcccgaagaaaatttcactgccgaccatccattccttttc
tttattcggcataattcctcaggtagcatcctattcttggggagattttcttccccttag

KEGG   Homo sapiens (human): 5269Help
Entry
5269              CDS       T01001                                 

Gene name
SERPINB6, CAP, DFNB91, MSTP057, PI-6, PI6, PTI, SPI3
Definition
(RefSeq) serpin family B member 6
  KO
K13963  serpin B
Organism
hsa  Homo sapiens (human)
Pathway
hsa05146  Amoebiasis
Disease
H00605  Deafness, autosomal recessive
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    5269 (SERPINB6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    5269 (SERPINB6)
Peptidases and inhibitors [BR:hsa01002]
 Peptidase inhibitors
  Family I4: serpin family
   5269 (SERPINB6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Serpin DUF4998
Motif
Other DBs
NCBI-GeneID: 5269
NCBI-ProteinID: NP_001258753
OMIM: 173321
HGNC: 8950
Ensembl: ENSG00000124570
Vega: OTTHUMG00000016170
Pharos: P35237(Tbio)
UniProt: P35237 A0A024QZX3
Position
6p25.2
AA seq 376 aa AA seqDB search
MDVLAEANGTFALNLLKTLGKDNSKNVFFSPMSMSCALAMVYMGAKGNTAAQMAQILSFN
KSGGGGDIHQGFQSLLTEVNKTGTQYLLRMANRLFGEKSCDFLSSFRDSCQKFYQAEMEE
LDFISAVEKSRKHINTWVAEKTEGKIAELLSPGSVDPLTRLVLVNAVYFRGNWDEQFDKE
NTEERLFKVSKNEEKPVQMMFKQSTFKKTYIGEIFTQILVLPYVGKELNMIIMLPDETTD
LRTVEKELTYEKFVEWTRLDMMDEEEVEVSLPRFKLEESYDMESVLRNLGMTDAFELGKA
DFSGMSQTDLSLSKVVHKSFVEVNEEGTEAAAATAAIMMMRCARFVPRFCADHPFLFFIQ
HSKTNGILFCGRFSSP
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggatgttctcgcagaagcaaatggcacctttgccttaaaccttttgaaaacgctgggt
aaagacaactcgaagaatgtgtttttctcacccatgagcatgtcctgtgccctggccatg
gtctacatgggggcaaagggaaacaccgctgcacagatggcccagatactttctttcaat
aaaagtggcggtggtggagacatccaccagggcttccagtctcttctcaccgaagtgaac
aagactggcacgcagtacttgcttaggatggccaacaggctctttggggaaaagtcttgt
gatttcctctcatcttttagagattcctgccaaaaattctaccaagcagagatggaggag
cttgactttatcagcgccgtagagaagtccagaaaacacataaacacctgggtagctgaa
aagacagaaggtaaaattgcggagttgctctctccgggctcagtggatccattgacaagg
ctggttctggtgaatgctgtctatttcagaggaaactgggatgaacagtttgacaaggag
aacaccgaggagagactgtttaaagtcagcaagaatgaggagaaacctgtgcaaatgatg
tttaagcaatctacttttaagaagacctatataggagaaatatttacccaaatcttggtg
cttccatatgttggcaaggaactgaatatgatcatcatgcttccggacgagaccactgac
ttgagaacggtggagaaagaactcacttacgagaagttcgtagaatggacgaggctggac
atgatggatgaagaggaggtggaagtgtccctcccgcggtttaaactagaggaaagctac
gacatggagagtgtcctgcgcaacctgggcatgactgatgccttcgagctgggcaaggca
gacttctctggaatgtcccagacagacctgtctctgtccaaggtcgtgcacaagtctttt
gtggaggtcaatgaggaaggcacggaggctgcagccgccacagctgccatcatgatgatg
cggtgtgccagattcgtcccccgcttctgcgccgaccaccccttccttttcttcatccag
cacagcaagaccaacgggattctcttctgcggccgcttttcctctccgtga

KEGG   Homo sapiens (human): 5272Help
Entry
5272              CDS       T01001                                 

Gene name
SERPINB9, CAP-3, CAP3, PI-9, PI9
Definition
(RefSeq) serpin family B member 9
  KO
K13963  serpin B
Organism
hsa  Homo sapiens (human)
Pathway
hsa05146  Amoebiasis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    5272 (SERPINB9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    5272 (SERPINB9)
Peptidases and inhibitors [BR:hsa01002]
 Peptidase inhibitors
  Family I4: serpin family
   5272 (SERPINB9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Serpin Thioredoxin_6
Motif
Other DBs
NCBI-GeneID: 5272
NCBI-ProteinID: NP_004146
OMIM: 601799
HGNC: 8955
Ensembl: ENSG00000170542
Vega: OTTHUMG00000014131
Pharos: P50453(Tbio)
UniProt: P50453 A0A024QZT4
Position
6p25.2
AA seq 376 aa AA seqDB search
METLSNASGTFAIRLLKILCQDNPSHNVFCSPVSISSALAMVLLGAKGNTATQMAQALSL
NTEEDIHRAFQSLLTEVNKAGTQYLLRTANRLFGEKTCQFLSTFKESCLQFYHAELKELS
FIRAAEESRKHINTWVSKKTEGKIEELLPGSSIDAETRLVLVNAIYFKGKWNEPFDETYT
REMPFKINQEEQRPVQMMYQEATFKLAHVGEVRAQLLELPYARKELSLLVLLPDDGVELS
TVEKSLTFEKLTAWTKPDCMKSTEVEVLLPKFKLQEDYDMESVLRHLGIVDAFQQGKADL
SAMSAERDLCLSKFVHKSFVEVNEEGTEAAAASSCFVVAECCMESGPRFCADHPFLFFIR
HNRANSILFCGRFSSP
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggaaactctttctaatgcaagtggtacttttgccatacgccttttaaagatactgtgt
caagataacccttcgcacaacgtgttctgttctcctgtgagcatctcctctgccctggcc
atggttctcctaggggcaaagggaaacaccgcaacccagatggcccaggcactgtcttta
aacacagaggaagacattcatcgggctttccagtcgcttctcactgaagtgaacaaggct
ggcacacagtacctgctgagaacggccaacaggctctttggagagaaaacttgtcagttc
ctctcaacgtttaaggaatcctgtcttcaattctaccatgctgagctgaaggagctttcc
tttatcagagctgcagaagagtccaggaaacacatcaacacctgggtctcaaaaaagacc
gaaggtaaaattgaagagttgttgccgggtagctcaattgatgcagaaaccaggctggtt
cttgtcaatgccatctacttcaaaggaaagtggaatgaaccgtttgacgaaacatacaca
agggaaatgccctttaaaataaaccaggaggagcaaaggccagtgcagatgatgtatcag
gaggccacgtttaagctcgcccacgtgggcgaggtgcgcgcgcagctgctggagctgccc
tacgccaggaaggagctgagcctgctggtgctgctgcctgacgacggcgtggagctcagc
acggtggaaaaaagtctcacttttgagaaactcacagcctggaccaagccagactgtatg
aagagtactgaggttgaagttctccttccaaaatttaaactacaagaggattatgacatg
gaatctgtgcttcggcatttgggaattgttgatgccttccaacagggcaaggctgacttg
tcggcaatgtcagcggagagagacctgtgtctgtccaagttcgtgcacaagagttttgtg
gaggtgaatgaagaaggcaccgaggcagcggcagcgtcgagctgctttgtagttgcagag
tgctgcatggaatctggccccaggttctgtgctgaccaccctttccttttcttcatcagg
cacaacagagccaacagcattctgttctgtggcaggttctcatcgccataa

KEGG   Homo sapiens (human): 5273Help
Entry
5273              CDS       T01001                                 

Gene name
SERPINB10, PI-10, PI10
Definition
(RefSeq) serpin family B member 10
  KO
K13963  serpin B
Organism
hsa  Homo sapiens (human)
Pathway
hsa05146  Amoebiasis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    5273 (SERPINB10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    5273 (SERPINB10)
Peptidases and inhibitors [BR:hsa01002]
 Peptidase inhibitors
  Family I4: serpin family
   5273 (SERPINB10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Serpin WcbI
Motif
Other DBs
NCBI-GeneID: 5273
NCBI-ProteinID: NP_005015
OMIM: 602058
HGNC: 8942
Ensembl: ENSG00000242550
Vega: OTTHUMG00000060594
Pharos: P48595(Tbio)
UniProt: P48595 B2RC45
Position
18q22.1
AA seq 397 aa AA seqDB search
MDSLATSINQFALELSKKLAESAQGKNIFFSSWSISTSLTIVYLGAKGTTAAQMAQVLQF
NRDQGVKCDPESEKKRKMEFNLSNSEEIHSDFQTLISEILKPNDDYLLKTANAIYGEKTY
AFHNKYLEDMKTYFGAEPQPVNFVEASDQIRKDINSWVERQTEGKIQNLLPDDSVDSTTR
MILVNALYFKGIWEHQFLVQNTTEKPFRINETTSKPVQMMFMKKKLHIFHIEKPKAVGLQ
LYYKSRDLSLLILLPEDINGLEQLEKAITYEKLNEWTSADMMELYEVQLHLPKFKLEDSY
DLKSTLSSMGMSDAFSQSKADFSGMSSARNLFLSNVFHKAFVEINEQGTEAAAGSGSEID
IRIRVPSIEFNANHPFLFFIRHNKTNTILFYGRLCSP
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggactctctagcaacatcaatcaaccagtttgccctggagttgagcaaaaagctagct
gaatctgctcagggtaaaaatatcttcttttcttcctggagcatctcaacttccttgacc
atagtgtatttgggcgccaaaggtaccactgcagcccaaatggcccaggtgcttcaattt
aacagagaccagggagtcaaatgtgaccctgaaagtgaaaaaaaaaggaaaatggaattc
aacttgagcaactcggaagaaatacactctgatttccaaacacttatctcagaaatcctc
aagcccaacgatgactacttacttaaaacagccaatgcgatatatggagagaaaacgtat
gcatttcacaataaatatttagaagacatgaaaacatattttggtgcagaacctcagcct
gttaactttgtggaagcttctgatcaaatcagaaaggacatcaactcttgggttgaaaga
cagaccgagggtaaaatccagaatctcctgcctgatgactctgtggattccacaaccagg
atgattctggtgaacgccctatactttaaaggaatctgggaacatcaattcttagtgcaa
aacaccacagaaaagccttttagaataaacgagactacaagcaaaccagtgcaaatgatg
tttatgaagaaaaagcttcacatttttcacatagaaaagccaaaagcagtgggccttcaa
ctctactacaaaagccgtgacctcagcctgcttatactactgccagaagacattaatggg
ctggaacagctggaaaaggccatcacctatgagaagctgaatgagtggaccagtgcagac
atgatggagttgtatgaagtgcagctacaccttcccaagttcaagctggaagacagttat
gatctcaagtcaaccctgagcagtatggggatgagtgatgccttcagccaaagcaaagct
gatttctcaggaatgtcttcagcaagaaacctatttttgtccaatgttttccataaggct
tttgtggaaataaatgaacaaggtactgaagctgcagctggcagtgggagtgagatagat
atacgaattagagtcccatccattgaattcaatgcaaatcacccattcctcttcttcatc
aggcacaataaaaccaacaccattcttttttatggaagattatgctccccctaa

KEGG   Homo sapiens (human): 5275Help
Entry
5275              CDS       T01001                                 

Gene name
SERPINB13, HSHUR7SEQ, HUR7, PI13, headpin
Definition
(RefSeq) serpin family B member 13
  KO
K13963  serpin B
Organism
hsa  Homo sapiens (human)
Pathway
hsa05146  Amoebiasis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    5275 (SERPINB13)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    5275 (SERPINB13)
Peptidases and inhibitors [BR:hsa01002]
 Peptidase inhibitors
  Family I4: serpin family
   5275 (SERPINB13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Serpin Lip_prot_lig_C
Motif
Other DBs
NCBI-GeneID: 5275
NCBI-ProteinID: NP_036529
OMIM: 604445
HGNC: 8944
Ensembl: ENSG00000197641
Vega: OTTHUMG00000060406
Pharos: Q9UIV8(Tbio)
UniProt: Q9UIV8
Position
18q21.33
AA seq 391 aa AA seqDB search
MDSLGAVSTRLGFDLFKELKKTNDGNIFFSPVGILTAIGMVLLGTRGATASQLEEVFHSE
KETKSSRIKAEEKEVIENTEAVHQQFQKFLTEISKLTNDYELNITNRLFGEKTYLFLQKY
LDYVEKYYHASLEPVDFVNAADESRKKINSWVESKTNEKIKDLFPDGSISSSTKLVLVNM
VYFKGQWDREFKKENTKEEKFWMNKSTSKSVQMMTQSHSFSFTFLEDLQAKILGIPYKNN
DLSMFVLLPNDIDGLEKIIDKISPEKLVEWTSPGHMEERKVNLHLPRFEVEDGYDLEAVL
AAMGMGDAFSEHKADYSGMSSGSGLYAQKFLHSSFVAVTEEGTEAAAATGIGFTVTSAPG
HENVHCNHPFLFFIRHNESNSILFFGRFSSP
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggattcacttggcgccgtcagcactcgacttgggtttgatcttttcaaagagctgaag
aaaacaaatgatggcaacatcttcttttcccctgtgggcatcttgactgcaattggcatg
gtcctcctggggacccgaggagccaccgcttcccagttggaggaggtgtttcactctgaa
aaagagacgaagagctcaagaataaaggctgaagaaaaagaggtgattgagaacacagaa
gcagtacatcaacaattccaaaagtttttgactgaaataagcaaactcactaatgattat
gaactgaacataaccaacaggctgtttggagaaaaaacatacctcttccttcaaaaatac
ttagattatgttgaaaaatattatcatgcatctctggaacctgttgattttgtaaatgca
gccgatgaaagtcgaaagaagattaattcctgggttgaaagcaaaacaaatgaaaaaatc
aaggacttgttcccagatggctctattagtagctctaccaagctggtgctggtgaacatg
gtttattttaaagggcaatgggacagggagtttaagaaagaaaatactaaggaagagaaa
ttttggatgaataagagcacaagtaaatctgtacagatgatgacacagagccattccttt
agcttcactttcctggaggacttgcaggccaaaattctagggattccatataaaaacaac
gacctaagcatgtttgtgcttctgcccaacgacatcgatggcctggagaagataatagat
aaaataagtcctgagaaattggtagagtggactagtccagggcatatggaagaaagaaag
gtgaatctgcacttgccccggtttgaggtggaggacggttacgatctagaggcggtcctg
gctgccatggggatgggcgatgccttcagtgagcacaaagccgactactcgggaatgtcg
tcaggctccgggttgtacgcccagaagttcctgcacagttcctttgtggcagtaactgag
gaaggcaccgaggctgcagctgccaccggcataggctttactgtcacatccgccccaggt
catgaaaatgttcactgcaatcatcccttcctgttcttcatcaggcacaatgaatccaac
agcatcctcttcttcggcagattttcttctccttaa

KEGG   Homo sapiens (human): 6317Help
Entry
6317              CDS       T01001                                 

Gene name
SERPINB3, HsT1196, SCC, SCCA-1, SCCA-PD, SCCA1, SSCA1, T4-A
Definition
(RefSeq) serpin family B member 3
  KO
K13963  serpin B
Organism
hsa  Homo sapiens (human)
Pathway
hsa05146  Amoebiasis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    6317 (SERPINB3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    6317 (SERPINB3)
Peptidases and inhibitors [BR:hsa01002]
 Peptidase inhibitors
  Family I4: serpin family
   6317 (SERPINB3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Serpin Sec-ASP3 TctC
Motif
Other DBs
NCBI-GeneID: 6317
NCBI-ProteinID: NP_008850
OMIM: 600517
HGNC: 10569
Ensembl: ENSG00000057149
Vega: OTTHUMG00000060403
Pharos: P29508(Tbio)
UniProt: P29508
Structure
PDB: 

Position
18q21.33
AA seq 390 aa AA seqDB search
MNSLSEANTKFMFDLFQQFRKSKENNIFYSPISITSALGMVLLGAKDNTAQQIKKVLHFD
QVTENTTGKAATYHVDRSGNVHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYLFLQEYL
DAIKKFYQTSVESVDFANAPEESRKKINSWVESQTNEKIKNLIPEGNIGSNTTLVLVNAI
YFKGQWEKKFNKEDTKEEKFWPNKNTYKSIQMMRQYTSFHFASLEDVQAKVLEIPYKGKD
LSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRETRVDLHLPRFKVEESYDLKDTLR
TMGMVDIFNGDADLSGMTGSRGLVLSGVLHKAFVEVTEEGAEAAAATAVVGFGSSPTSTN
EEFHCNHPFLFFIRQNKTNSILFYGRFSSP
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgaattcactcagtgaagccaacaccaagttcatgttcgacctgttccaacagttcaga
aaatcaaaagagaacaacatcttctattcccctatcagcatcacatcagcattagggatg
gtcctcttaggagccaaagacaacactgcacaacagattaagaaggttcttcactttgat
caagtcacagagaacaccacaggaaaagctgcaacatatcatgttgataggtcaggaaat
gttcatcaccagtttcaaaagcttctgactgaattcaacaaatccactgatgcatatgag
ctgaagatcgccaacaagctcttcggagaaaaaacgtatctatttttacaggaatattta
gatgccatcaagaaattttaccagaccagtgtggaatctgttgattttgcaaatgctcca
gaagaaagtcgaaagaagattaactcctgggtggaaagtcaaacgaatgaaaaaattaaa
aacctaattcctgaaggtaatattggcagcaataccacattggttcttgtgaacgcaatc
tatttcaaagggcagtgggagaagaaatttaataaagaagatactaaagaggaaaaattt
tggccaaacaagaatacatacaagtccatacagatgatgaggcaatacacatcttttcat
tttgcctcgctggaggatgtacaggccaaggtcctggaaataccatacaaaggcaaagat
ctaagcatgattgtgttgctgccaaatgaaatcgatggtctccagaagcttgaagagaaa
ctcactgctgagaaattgatggaatggacaagtttgcagaatatgagagagacacgtgtc
gatttacacttacctcggttcaaagtggaagagagctatgacctcaaggacacgttgaga
accatgggaatggtggatatcttcaatggggatgcagacctctcaggcatgaccgggagc
cgcggtctcgtgctatctggagtcctacacaaggcctttgtggaggttacagaggaggga
gcagaagctgcagctgccaccgctgtagtaggattcggatcatcacctacttcaactaat
gaagagttccattgtaatcaccctttcctattcttcataaggcaaaataagaccaacagc
atcctcttctatggcagattctcatccccgtag

KEGG   Homo sapiens (human): 6318Help
Entry
6318              CDS       T01001                                 

Gene name
SERPINB4, LEUPIN, PI11, SCCA-2, SCCA1, SCCA2
Definition
(RefSeq) serpin family B member 4
  KO
K13963  serpin B
Organism
hsa  Homo sapiens (human)
Pathway
hsa05146  Amoebiasis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    6318 (SERPINB4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    6318 (SERPINB4)
Peptidases and inhibitors [BR:hsa01002]
 Peptidase inhibitors
  Family I4: serpin family
   6318 (SERPINB4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Serpin TctC
Motif
Other DBs
NCBI-GeneID: 6318
NCBI-ProteinID: NP_002965
OMIM: 600518
HGNC: 10570
Ensembl: ENSG00000206073
Vega: OTTHUMG00000060405
Pharos: P48594(Tbio)
UniProt: P48594
Position
18q21.33
AA seq 390 aa AA seqDB search
MNSLSEANTKFMFDLFQQFRKSKENNIFYSPISITSALGMVLLGAKDNTAQQISKVLHFD
QVTENTTEKAATYHVDRSGNVHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYQFLQEYL
DAIKKFYQTSVESTDFANAPEESRKKINSWVESQTNEKIKNLFPDGTIGNDTTLVLVNAI
YFKGQWENKFKKENTKEEKFWPNKNTYKSVQMMRQYNSFNFALLEDVQAKVLEIPYKGKD
LSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRETCVDLHLPRFKMEESYDLKDTLR
TMGMVNIFNGDADLSGMTWSHGLSVSKVLHKAFVEVTEEGVEAAAATAVVVVELSSPSTN
EEFCCNHPFLFFIRQNKTNSILFYGRFSSP
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgaattcactcagtgaagccaacaccaagttcatgttcgatctgttccaacagttcaga
aaatcaaaagagaacaacatcttctattcccctatcagcatcacatcagcattagggatg
gtcctcttaggagccaaagacaacactgcacaacaaattagcaaggttcttcactttgat
caagtcacagagaacaccacagaaaaagctgcaacatatcatgttgataggtcaggaaat
gttcatcaccagtttcaaaagcttctgactgaattcaacaaatccactgatgcatatgag
ctgaagatcgccaacaagctcttcggagaaaagacgtatcaatttttacaggaatattta
gatgccatcaagaaattttaccagaccagtgtggaatctactgattttgcaaatgctcca
gaagaaagtcgaaagaagattaactcctgggtggaaagtcaaacgaatgaaaaaattaaa
aacctatttcctgatgggactattggcaatgatacgacactggttcttgtgaacgcaatc
tatttcaaagggcagtgggagaataaatttaaaaaagaaaacactaaagaggaaaaattt
tggccaaacaagaatacatacaaatctgtacagatgatgaggcaatacaattcctttaat
tttgccttgctggaggatgtacaggccaaggtcctggaaataccatacaaaggcaaagat
ctaagcatgattgtgctgctgccaaatgaaatcgatggtctgcagaagcttgaagagaaa
ctcactgctgagaaattgatggaatggacaagtttgcagaatatgagagagacatgtgtc
gatttacacttacctcggttcaaaatggaagagagctatgacctcaaggacacgttgaga
accatgggaatggtgaatatcttcaatggggatgcagacctctcaggcatgacctggagc
cacggtctctcagtatctaaagtcctacacaaggcctttgtggaggtcactgaggaggga
gtggaagctgcagctgccaccgctgtagtagtagtcgaattatcatctccttcaactaat
gaagagttctgttgtaatcaccctttcctattcttcataaggcaaaataagaccaacagc
atcctcttctatggcagattctcatccccatag

DBGET integrated database retrieval system