KEGG   Homo sapiens (human): 1994Help
Entry
1994              CDS       T01001                                 

Gene name
ELAVL1, ELAV1, HUR, Hua, MelG
Definition
(RefSeq) ELAV like RNA binding protein 1
  KO
K13088  ELAV-like protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04152  AMPK signaling pathway
hsa04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    1994 (ELAVL1)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    1994 (ELAVL1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    1994 (ELAVL1)
   03041 Spliceosome [BR:hsa03041]
    1994 (ELAVL1)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Ran-mediated transport factors
     1994 (ELAVL1)
   mRNA cycle factors
    Stress granule specific factors
     1994 (ELAVL1)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   General mRNP proteins
    1994 (ELAVL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 RRM_5 BRAP2 RRM_3 E2
Motif
Other DBs
NCBI-GeneID: 1994
NCBI-ProteinID: NP_001410
OMIM: 603466
HGNC: 3312
Ensembl: ENSG00000066044
Vega: OTTHUMG00000182470
Pharos: Q15717(Tchem)
UniProt: Q15717
Structure
PDB: 

Position
19p13.2
AA seq 326 aa AA seqDB search
MSNGYEDHMAEDCRGDIGRTNLIVNYLPQNMTQDELRSLFSSIGEVESAKLIRDKVAGHS
LGYGFVNYVTAKDAERAINTLNGLRLQSKTIKVSYARPSSEVIKDANLYISGLPRTMTQK
DVEDMFSRFGRIINSRVLVDQTTGLSRGVAFIRFDKRSEAEEAITSFNGHKPPGSSEPIT
VKFAANPNQNKNVALLSQLYHSPARRFGGPVHHQAQRFRFSPMGVDHMSGLSGVNVPGNA
SSGWCIFIYNLGQDADEGILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYEEAAM
AIASLNGYRLGDKILQVSFKTNKSHK
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgtctaatggttatgaagaccacatggccgaagactgcaggggtgacatcgggagaacg
aatttgatcgtcaactacctccctcagaacatgacccaggatgagttacgaagcctgttc
agcagcattggtgaagttgaatctgcaaaacttattcgggataaagtagcaggacacagc
ttgggctatggctttgtgaactacgtgaccgcgaaggatgcagagagagcgatcaacacg
ctgaacggcttgaggctccagtcaaaaaccattaaggtgtcgtatgctcgcccgagctca
gaggtgatcaaagacgccaacttgtacatcagcgggctcccgcggaccatgacccagaag
gacgtagaagacatgttctctcggtttgggcggatcatcaactcgcgggtcctcgtggat
cagactacaggtttgtccagaggggttgcgtttatccggtttgacaaacggtcggaggca
gaagaggcaattaccagtttcaatggtcataaacccccaggttcctctgagcccatcaca
gtgaagtttgcagccaaccccaaccagaacaaaaacgtggcactcctctcgcagctgtac
cactcgccagcgcgacggttcggaggccccgttcaccaccaggcgcagagattcaggttc
tcccccatgggcgtcgatcacatgagcgggctctctggcgtcaacgtgccaggaaacgcc
tcctccggctggtgcattttcatctacaacctggggcaggatgccgacgaggggatcctc
tggcagatgtttgggccgtttggtgccgtcaccaatgtgaaagtgatccgcgacttcaac
accaacaagtgcaaagggtttggctttgtgaccatgacaaactatgaagaagccgcgatg
gccatagccagcctgaacggctaccgcctgggggacaaaatcttacaggtttccttcaaa
accaacaagtcccacaaataa

DBGET integrated database retrieval system