KEGG   Homo sapiens (human): 1995Help
Entry
1995              CDS       T01001                                 

Gene name
ELAVL3, HUC, HUCL, PLE21
Definition
(RefSeq) ELAV like RNA binding protein 3
  KO
K13208  ELAV like protein 2/3/4
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    1995 (ELAVL3)
   03041 Spliceosome [BR:hsa03041]
    1995 (ELAVL3)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Ran-mediated transport factors
     1995 (ELAVL3)
Spliceosome [BR:hsa03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    1995 (ELAVL3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 RRM_5 BRAP2 RRM_occluded RRM_3
Motif
Other DBs
NCBI-GeneID: 1995
NCBI-ProteinID: NP_001411
OMIM: 603458
HGNC: 3314
Ensembl: ENSG00000196361
Vega: OTTHUMG00000182030
Pharos: Q14576(Tbio)
UniProt: Q14576
Position
19p13.2
AA seq 367 aa AA seqDB search
MVTQILGAMESQVGGGPAGPALPNGPLLGTNGATDDSKTNLIVNYLPQNMTQDEFKSLFG
SIGDIESCKLVRDKITGQSLGYGFVNYSDPNDADKAINTLNGLKLQTKTIKVSYARPSSA
SIRDANLYVSGLPKTMSQKEMEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAE
EAIKGLNGQKPLGAAEPITVKFANNPSQKTGQALLTHLYQSSARRYAGPLHHQTQRFRLD
NLLNMAYGVKSPLSLIARFSPIAIDGMSGLAGVGLSGGAAGAGWCIFVYNLSPEADESVL
WQLFGPFGAVTNVKVIRDFTTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGERVLQVSFK
TSKQHKA
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggtcactcagatactgggggccatggagtctcaggtgggggggggcccggccggcccg
gccctgcccaacgggccactccttggtacaaatggagccactgacgacagcaagaccaac
ctcatcgtcaactacctgccccagaacatgacccaggatgagttcaagagtctcttcggc
agcattggcgacatcgagtcctgcaagttggttcgggacaagatcacagggcagagcctt
ggctacgggtttgtgaactattctgaccccaatgatgcagacaaagccatcaacaccctc
aacggcctcaaattacagacgaagaccatcaaggtgtcctatgccagacccagttcagca
tccatccgggatgctaacctgtacgtcagcgggctccccaagaccatgagccagaaagag
atggagcagctcttctcccagtacggccgcatcatcacgtcccgcatcctggtggaccag
gtcacaggtgtctctcggggtgtgggattcatccgctttgacaagaggattgaggccgaa
gaggctatcaaaggactgaatgggcagaagccgctgggcgcagctgagcccatcacagtc
aagttcgcgaacaacccaagtcagaagacggggcaggcgctgctcacccacctctaccag
tcatccgcccggcgctacgcaggccccctacaccatcagacccagcgtttccggctggac
aatttgctcaacatggcctacggcgtcaagagtcccctgtcgctcatcgccaggttctcg
ccgatcgccatcgatggtatgagcggcctggcgggcgtgggcctgtcggggggcgcggcg
ggcgccggctggtgcatcttcgtgtacaacctgtcaccggaggcagacgagagcgtgctg
tggcagctgttcgggccttttggggcagtcaccaacgtcaaggtcatccgtgatttcacc
accaacaagtgcaagggtttcggcttcgtgaccatgaccaactatgacgaggcggccatg
gccatcgccagcctgaacggctatcgcctgggcgagcgcgtgctgcaggtctccttcaag
accagcaaacagcacaaggcgtga

DBGET integrated database retrieval system