KEGG   Homo sapiens (human): 1996Help
Entry
1996              CDS       T01001                                 

Gene name
ELAVL4, HUD, PNEM
Definition
(RefSeq) ELAV like RNA binding protein 4
  KO
K13208  ELAV like protein 2/3/4
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    1996 (ELAVL4)
   03041 Spliceosome [BR:hsa03041]
    1996 (ELAVL4)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Ran-mediated transport factors
     1996 (ELAVL4)
Spliceosome [BR:hsa03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    1996 (ELAVL4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 RRM_5 BRAP2 RRM_3
Motif
Other DBs
NCBI-GeneID: 1996
NCBI-ProteinID: NP_001311142
OMIM: 168360
HGNC: 3315
Ensembl: ENSG00000162374
Vega: OTTHUMG00000007877
Pharos: P26378(Tbio)
UniProt: P26378
Structure
PDB: 

Position
1p33-p32.3
AA seq 385 aa AA seqDB search
MEWNGLKMIISTMEPQVSNGPTSNTSNGPSSNNRNCPSPMQTGATTDDSKTNLIVNYLPQ
NMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINTLNGLRLQTK
TIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGV
GFIRFDKRIEAEEAIKGLNGQKPSGATEPITVKFANNPSQKSSQALLSQLYQSPNRRYPG
PLHHQAQRFRLDNLLNMAYGVKRLMSGPVPPSACPPRFSPITIDGMTSLVGMNIPGHTGT
GWCIFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAI
ASLNGYRLGDRVLQVSFKTNKAHKS
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggagtggaatggcttgaagatgataattagcaccatggagcctcaggtgtcaaatggt
ccgacatccaatacaagcaatggaccctccagcaacaacagaaactgtccttctcccatg
caaacaggggcaaccacagatgacagcaaaaccaacctcatcgtcaactatttaccccag
aatatgacccaagaagaattcaggagtctcttcgggagcattggtgaaatagaatcctgc
aaacttgtgagagacaaaattacaggacagagtttagggtatggatttgttaactatatt
gatccaaaggatgcagagaaagccatcaacactttaaatggactcagactccagaccaaa
accataaaggtctcatatgcccgtccgagctctgcctcaatcagggatgctaacctctat
gttagcggccttcccaaaaccatgacccagaaggaactggagcaacttttctcgcaatac
ggccgtatcatcacctcacgaatcctggttgatcaagtcacaggagtgtccagaggggtg
ggattcatccgctttgataagaggattgaggcagaagaagccatcaaagggctgaatggc
cagaagcccagcggtgctacggaaccgattactgtgaagtttgccaacaaccccagccag
aagtccagccaggccctgctctcccagctctaccagtcccccaaccggcgctacccaggt
ccacttcaccaccaggctcagaggttcaggctggacaatttgcttaatatggcctatggc
gtaaagagactgatgtctggaccagtccccccttctgcttgtccccccaggttctcccca
attaccattgatggaatgacaagccttgtgggaatgaacatccctggtcacacaggaact
gggtggtgcatctttgtctacaacctgtcccccgattccgatgagagtgtcctctggcag
ctctttggcccctttggagcagtgaacaacgtaaaggtgattcgtgacttcaacaccaac
aagtgcaagggattcggctttgtcaccatgaccaactatgatgaggcggccatggccatc
gccagcctcaacgggtaccgcctgggagacagagtgttgcaagtttcctttaaaaccaac
aaagcccacaagtcctga

DBGET integrated database retrieval system