KEGG   Homo sapiens (human): 199675
Entry
199675            CDS       T01001                                 

Gene name
MCEMP1, C19orf59
Definition
(RefSeq) mast cell expressed membrane protein 1
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Lectin_N NPV_P10 DUF948 Ciart Noelin-1 THOC7 LapA_dom MCPsignal HIP1_clath_bdg
Other DBs
NCBI-GeneID: 199675
NCBI-ProteinID: NP_777578
OMIM: 609565
HGNC: 27291
Ensembl: ENSG00000183019
Vega: OTTHUMG00000182440
Pharos: Q8IX19(Tdark)
UniProt: Q8IX19 A0A384NYE9
Position
19p13.2
AA seq 187 aa
MEVEEIYKHQEVKMQAPAFRDKKQGVSAKNQGAHDPDYENITLAFKNQDHAKGGHSRPTS
QVPAQCRPPSDSTQVPCWLYRAILSLYILLALAFVLCIILSAFIMVKNAEMSKELLGFKR
ELWNVSNSVQACEERQKRGWDSVQQSITMVRSKIDRLETTLAGIKNIDTKVQKILEVLQK
MPQSSPQ
NT seq 564 nt   +upstreamnt  +downstreamnt
atggaagtggaggaaatctacaagcaccaggaagtcaagatgcaagcaccagccttcagg
gacaagaaacagggggtctcagccaagaatcaaggtgcccatgacccagactatgagaat
atcaccttggccttcaaaaatcaggaccatgcaaagggtggtcattcacgacccacgagc
caagtcccagcccagtgcaggccgccctcagactccacccaggtcccctgctggttgtac
agagccatcctgagcctgtacatcctcctggccctggcctttgtcctctgcatcatcctg
tcagccttcatcatggtgaagaatgctgagatgtccaaggagctgctgggctttaaaagg
gagctttggaatgtctcaaactccgtacaagcatgcgaagagagacagaagagaggctgg
gattccgttcagcagagcatcaccatggtcaggagcaagattgatagattagagacgaca
ttagcaggcataaaaaacattgacacaaaggtacagaaaatcttggaggtgctgcagaaa
atgccacagtcctcacctcaataa

DBGET integrated database retrieval system