KEGG   Homo sapiens (human): 199704
Entry
199704            CDS       T01001                                 

Gene name
ZNF585A, Zfp27
Definition
(RefSeq) zinc finger protein 585A
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    199704 (ZNF585A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    199704 (ZNF585A)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    199704 (ZNF585A)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB Zn-ribbon_8 zf-C2H2_6 DZR zf-C2H2_jaz DUF3268 zinc_ribbon_15 C1_4 Zn_ribbon_SprT zf-met zf-LYAR zf-C2H2_11
Other DBs
NCBI-GeneID: 199704
NCBI-ProteinID: NP_001275729
HGNC: 26305
Ensembl: ENSG00000196967
Vega: OTTHUMG00000181857
Pharos: Q6P3V2(Tdark)
UniProt: Q6P3V2
Position
19q13.12
AA seq 769 aa
MPANWTSPQKSSALAPEDHGSSYEGSVSFRDVAIDFSREEWRHLDPSQRNLYRDVMLETY
SHLLSVGYQVPEAEVVMLEQGKEPWALQGERPRQSCPGEKLWDHNQCRKILSYKQVSSQP
QKMYPGEKAYECAKFEKIFTQKSQLKVHLKVLAGEKLYVCIECGKAFVQKPEFIIHQKTH
MREKPFKCNECGKSFFQVSSLFRHQRIHTGEKLYECSQCGKGFSYNSDLSIHEKIHTGER
HHECTDCGKAFTQKSTLKMHQKIHTGERSYICIECGQAFIQKTHLIAHRRIHTGEKPYEC
SNCGKSFISKSQLQVHQRVHTRVKPYICTEYGKVFSNNSNLVTHKKVQSREKSSICTECG
KAFTYRSELIIHQRIHTGEKPYECSDCGKAFTQKSALTVHQRIHTGEKSYICMKCGLAFI
QKAHLIAHQIIHTGEKPHKCGHCGKLFTSKSQLHVHKRIHTGEKPYMCNKCGKAFTNRSN
LITHQKTHTGEKSYICSKCGKAFTQRSDLITHQRIHTGEKPYECNTCGKAFTQKSHLNIH
QKIHTGERQYECHECGKAFNQKSILIVHQKIHTGEKPYVCTECGRAFIRKSNFITHQRIH
TGEKPYECSDCGKSFTSKSQLLVHQPVHTGEKPYVCAECGKAFSGRSNLSKHQKTHTGEK
PYICSECGKTFRQKSELITHHRIHTGEKPYECSDCGKSFTKKSQLQVHQRIHTGEKPYVC
AECGKAFTDRSNLNKHQTTHTGDKPYKCGICGKGFVQKSVFSVHQSSHA
NT seq 2310 nt   +upstreamnt  +downstreamnt
atgccagctaattggacctcacctcagaaatcctcagccctggctccagaggatcatggc
agctcctatgagggatcagtgtccttcagggatgtggctatcgatttcagcagagaggaa
tggcggcacctggacccttctcagagaaacctgtaccgggatgtgatgctggagacctac
agccacctgctctcagtaggatatcaagttcctgaagcagaggtggtcatgttggagcaa
ggaaaggaaccatgggcactgcagggtgagaggccacgtcagagctgcccaggagagaaa
ttatgggaccataatcaatgtagaaaaatcctcagttataaacaagtatcctctcaacct
caaaaaatgtatcctggggagaaagcttatgaatgcgccaaatttgaaaagatattcacc
cagaagtcacagctcaaagtacacctgaaagttcttgcaggagaaaagctctatgtatgc
attgaatgtgggaaggcttttgtacagaagccagaatttattatacaccagaaaacccat
atgagagagaaaccctttaaatgcaatgaatgtggaaaatccttttttcaagtgtcgtcc
ctcttcaggcatcagagaattcataccggagagaaactctatgaatgcagccagtgtggg
aaaggcttctcttataactcagatctcagtatacatgagaaaattcatactggagagaga
caccatgaatgcactgactgtggcaaagcattcacacaaaagtccacactcaagatgcat
cagaaaatccatacaggcgagagatcctacatctgtattgaatgcggacaggccttcatc
cagaagacccatttgattgcacaccgaagaattcatactggagaaaaaccatatgagtgc
agtaactgtggcaaatccttcatttccaagtcacaacttcaggtacatcaacgtgttcac
acaagagtgaagccctatatatgtaccgaatatgggaaggtcttcagcaataattccaac
ctcgttacacataagaaagttcaaagtagagagaaatcttccatatgtactgagtgtggg
aaggcctttacctacaggtcagagttgattattcatcagagaattcacactggagagaaa
ccttatgaatgcagtgactgtgggaaagccttcactcagaagtcagcactcacagtgcat
cagagaattcatacaggagaaaaatcgtatatatgcatgaaatgtggactggccttcatt
cagaaggcacacttgattgcacatcaaataattcatactggagagaaacctcataaatgt
ggtcactgtgggaaattgtttacctccaagtcgcaactccatgttcataaacgaattcac
acaggagaaaagccctatatgtgcaataaatgtgggaaggcattcaccaaccggtcaaat
ctcattacacatcagaaaactcatacaggagagaaatcttatatatgttccaaatgtgga
aaggccttcacccagaggtcagacttgattacacatcagagaatccatactggggagaag
ccttatgaatgcaatacttgtggaaaagccttcactcagaagtcacacctcaatatacat
cagaaaattcacactggagagagacagtatgaatgccacgaatgtgggaaagccttcaac
cagaaatcaatactcattgttcatcagaaaattcatacaggagagaaaccctatgtatgc
actgagtgtggaagagctttcatccgcaagtcaaactttattactcatcaaagaattcat
actggagagaagccttatgaatgcagtgactgtgggaagtcctttacctccaagtctcag
ctcctggtgcatcagccagttcacacaggagagaaaccctatgtgtgtgccgagtgcggg
aaggcctttagtggcaggtcaaatctcagtaagcaccagaaaactcataccggagaaaag
ccctacatttgttctgaatgtgggaagacctttcgacagaagtcagagttgattacacat
cacagaattcatactggagagaaaccttatgagtgcagtgactgtgggaagtctttcact
aaaaaatcacagctccaagtgcatcagcgaattcacactggagagaagccttacgtgtgt
gctgagtgtgggaaggcctttactgacaggtccaatttgaataaacatcagacaacacac
actggagacaaaccctacaagtgtggcatctgtgggaaaggcttcgttcagaaatcagtg
ttcagcgtccatcagagcagccacgcttga

DBGET integrated database retrieval system