KEGG   Homo sapiens (human): 199713Help
Entry
199713            CDS       T01001                                 

Gene name
NLRP7, CLR19.4, HYDM, NALP7, NOD12, PAN7, PYPAF3
Definition
(RefSeq) NLR family pyrin domain containing 7
  KO
K20864  NACHT, LRR and PYD domains-containing protein 7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04621  NOD-like receptor signaling pathway
Disease
H00289  Recurrent hydatidiform moles
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    199713 (NLRP7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:hsa04054]
    199713 (NLRP7)
Pattern recognition receptors [BR:hsa04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   199713 (NLRP7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NACHT PYRIN NLRC4_HD2 NOD2_WH LRR_6 AAA_16 AAA NB-ARC AAA_22 AAA_33 AAA_24 TsaE
Motif
Other DBs
NCBI-GeneID: 199713
NCBI-ProteinID: NP_996611
OMIM: 609661
HGNC: 22947
Ensembl: ENSG00000167634
Vega: OTTHUMG00000180428
Pharos: Q8WX94(Tbio)
UniProt: Q8WX94
Structure
PDB: 

Position
19q13.42
AA seq 980 aa AA seqDB search
MTSPQLEWTLQTLLEQLNEDELKSFKSLLWAFPLEDVLQKTPWSEVEEADGKKLAEILVN
TSSENWIRNATVNILEEMNLTELCKMAKAEMMEDGQVQEIDNPELGDAEEDSELAKPGEK
EGWRNSMEKQSLVWKNTFWQGDIDNFHDDVTLRNQRFIPFLNPRTPRKLTPYTVVLHGPA
GVGKTTLAKKCMLDWTDCNLSPTLRYAFYLSCKELSRMGPCSFAELISKDWPELQDDIPS
ILAQAQRILFVVDGLDELKVPPGALIQDICGDWEKKKPVPVLLGSLLKRKMLPRAALLVT
TRPRALRDLQLLAQQPIYVRVEGFLEEDRRAYFLRHFGDEDQAMRAFELMRSNAALFQLG
SAPAVCWIVCTTLKLQMEKGEDPVPTCLTRTGLFLRFLCSRFPQGAQLRGALRTLSLLAA
QGLWAQMSVFHREDLERLGVQESDLRLFLDGDILRQDRVSKGCYSFIHLSFQQFLTALFY
ALEKEEGEDRDGHAWDIGDVQKLLSGEERLKNPDLIQVGHFLFGLANEKRAKELEATFGC
RMSPDIKQELLQCKAHLHANKPLSVTDLKEVLGCLYESQEEELAKVVVAPFKEISIHLTN
TSEVMHCSFSLKHCQDLQKLSLQVAKGVFLENYMDFELDIEFERCTYLTIPNWARQDLRS
LRLWTDFCSLFSSNSNLKFLEVKQSFLSDSSVRILCDHVTRSTCHLQKVEIKNVTPDTAY
RDFCLAFIGKKTLTHLTLAGHIEWERTMMLMLCDLLRNHKCNLQYLRLGGHCATPEQWAE
FFYVLKANQSLKHLRLSANVLLDEGAMLLYKTMTRPKHFLQMLSLENCRLTEASCKDLAA
VLVVSKKLTHLCLAKNPIGDTGVKFLCEGLSYPDCKLQTLVLQQCSITKLGCRYLSEALQ
EACSLTNLDLSINQIARGLWILCQALENPNCNLKHLRLKTYETNLEIKKLLEEVKEKNPK
LTIDCNASGATAPPCCDFFC
NT seq 2943 nt NT seq  +upstreamnt  +downstreamnt
atgacatcgccccagctagagtggactctgcagacccttctggagcagctgaacgaggat
gaattaaagagtttcaaatcccttttatgggcttttcccctcgaagacgtgctacagaag
accccatggtctgaggtggaagaggctgatggcaagaaactggcagaaattctggtcaac
acctcctcagaaaattggataaggaatgcgactgtgaacatcttggaagagatgaatctc
acggaattgtgtaagatggcaaaggctgagatgatggaggacggacaggtgcaagaaata
gataatcctgagctgggagatgcagaagaagactcggagttagcaaagccaggtgaaaag
gaaggatggagaaattcaatggagaaacagtctttggtctggaagaacaccttttggcaa
ggagacattgacaatttccatgacgacgtcactctgagaaaccaacggttcattccattc
ttgaatcccagaacacccaggaagctaacaccttacacggtggtgctgcacggccccgca
ggcgtggggaaaaccacgctggccaaaaagtgtatgctggactggacagactgcaacctc
agcccgacgctcagatacgcgttctacctcagctgcaaggagctcagccgcatgggcccc
tgcagttttgcagagctgatctccaaagactggcctgaattgcaggatgacattccaagc
atcctagcccaagcacagagaatcctgttcgtggtcgatggccttgatgagctgaaagtc
ccacctggggcgctgatccaggacatctgcggggactgggagaagaagaagccggtgccc
gtcctcctggggagtttgctgaagaggaagatgttacccagggcagccttgctggtcacc
acgcggcccagggcactgagggacctccagctcctggcgcagcagccgatctacgtaagg
gtggagggcttcctggaggaggacaggagggcctatttcctgagacactttggagacgag
gaccaagccatgcgtgcctttgagctaatgaggagcaacgcggccctgttccagctgggc
tcggcccccgcggtgtgctggattgtgtgcacgactctgaagctgcagatggagaagggg
gaggacccggtccccacctgcctcacccgcacggggctgttcctgcgtttcctctgcagc
cggttcccgcagggcgcacagctgcggggcgcgctgcggacgctgagcctcctggccgcg
cagggcctgtgggcgcagatgtccgtgttccaccgagaggacctggaaaggctcggggtg
caggagtccgacctccgtctgttcctggacggagacatcctccgccaggacagagtctcc
aaaggctgctactccttcatccacctcagcttccagcagtttctcactgccctgttctac
gccctggagaaggaggagggggaggacagggacggccacgcctgggacatcggggacgta
cagaagctgctttccggagaagaaagactcaagaaccccgacctgattcaagtaggacac
ttcttattcggcctcgctaacgagaagagagccaaggagttggaggccacttttggctgc
cggatgtcaccggacatcaaacaggaattgctgcaatgcaaagcacatcttcatgcaaat
aagcccttatccgtgaccgacctgaaggaggtcttgggctgcctgtatgagtctcaggag
gaggagctggcgaaggtggtggtggccccgttcaaggaaatttctattcacctgacaaat
acttctgaagtgatgcattgttccttcagcctgaagcattgtcaagacttgcagaaactc
tcactgcaggtagcaaagggggtgttcctggagaattacatggattttgaactggacatt
gaatttgaaaggtgcacttacctaaccattccgaactgggctcggcaggatcttcgctct
cttcgcctctggacagatttctgctctctcttcagctcaaacagcaacctcaagtttctg
gaagtgaaacaaagcttcctgagtgactcttctgtgcggattctttgtgaccacgtaacc
cgtagcacctgtcatctgcagaaagtggagattaaaaacgtcacccctgacaccgcgtac
cgggacttctgtcttgctttcattgggaagaagaccctcacgcacctgaccctggcaggg
cacatcgagtgggaacgcacgatgatgctgatgctgtgtgacctgctcagaaatcataaa
tgcaacctgcagtacctgaggttgggaggtcactgtgccaccccggagcagtgggctgaa
ttcttctatgtcctcaaagccaaccagtccctgaagcacctgcgtctctcagccaatgtg
ctcctggatgagggtgccatgttgctgtacaagaccatgacacgcccaaaacacttcctg
cagatgttgtcgttggaaaactgtcgtcttacagaagccagttgcaaggaccttgctgct
gtcttggttgtcagcaagaagctgacacacctgtgcttggccaagaaccccattggggat
acaggggtgaagtttctgtgtgagggcttgagttaccctgattgtaaactgcagaccttg
gtgttacagcaatgcagcataaccaagcttggctgtagatatctctcagaggcgctccaa
gaagcctgcagcctcacaaacctggacttgagtatcaaccagatagctcgtggattgtgg
attctctgtcaggcattagagaatccaaactgtaacctaaaacacctacggttgaagacc
tatgaaactaatttggaaatcaagaagctgttggaggaagtgaaagaaaagaatcccaag
ctgactattgattgcaatgcttccggggcaacggcacctccgtgctgtgactttttttgc
tga

DBGET integrated database retrieval system