KEGG   Homo sapiens (human): 199746Help
Entry
199746            CDS       T01001                                 

Gene name
U2AF1L4, U2AF1-RS3, U2AF1L3, U2AF1L3V1, U2AF1RS3, U2af26
Definition
(RefSeq) U2 small nuclear RNA auxiliary factor 1 like 4
  KO
K12836  splicing factor U2AF 35 kDa subunit
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
hsa05131  Shigellosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    199746 (U2AF1L4)
 09160 Human Diseases
  09171 Infectious diseases: Bacterial
   05131 Shigellosis
    199746 (U2AF1L4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    199746 (U2AF1L4)
Spliceosome [BR:hsa03041]
 Complex A
  U2 snRNP components
   U2 related factors
    199746 (U2AF1L4)
 Complex B
    199746 (U2AF1L4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-CCCH RRM_1 zf_CCCH_4 Torus His_Phos_2
Motif
Other DBs
NCBI-GeneID: 199746
NCBI-ProteinID: NP_659424
OMIM: 601080
HGNC: 23020
Ensembl: ENSG00000161265
Vega: OTTHUMG00000182066
Pharos: Q8WU68(Tdark)
UniProt: Q8WU68
Position
19q13.12
AA seq 202 aa AA seqDB search
MAEYLASIFGTEKDKVNCSFYFKIGVCRHGDRCSRLHNKPTFSQEVFTELQEKYGEIEEM
NVCDNLGDHLVGNVYVKFRREEDGERAVAELSNRWFNGQAVHGNVPEVASATSCICGPFP
RTSRGSSMGGDPGAGHPRGSILATIPERGTIGVPLITGMAASEALAPLPFTPNRDRCSWQ
DLSSKPPSLSCPILPRLPGSIM
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggctgaatatttagcttcgatattcgggactgagaaggacaaggttaactgctctttt
tactttaagatcggggtctgccggcacggggaccggtgctcccggcttcacaacaagccg
acattcagccaggaggtgttcacagaactgcaggagaagtatggggagattgaagagatg
aatgtgtgcgacaaccttggggaccacctcgtgggcaacgtctatgtcaagttccggagg
gaggaggatggagagcgggccgtggctgaactcagtaaccgctggttcaacgggcaggct
gtgcacgggaatgtacccgaggtggcttctgcaacttcatgcatctgcggcccatttccc
agaacctccagaggcagctctatgggcggggacccaggcgcaggtcacccccgaggttcc
atactggccaccatccccgagagaggaaccatcggtgttcccctgatcactggcatggcc
gcttctgaggccctggcccccttacccttcacccccaacagggacagatgttcctggcag
gacctctcctcaaagcccccttcactctcctgccccatccttcccaggctcccgggctcc
ataatgtaa

DBGET integrated database retrieval system